Abstract
Blood clot formation induced by dysfunctional coagulation is a frequent complication of coronavirus disease 2019 (COVID-19) and a high-risk factor for severe illness and death. Neutrophil extracellular traps (NETs) are implicated in COVID-19-induced immunothrombosis. Furthermore, human cathelicidin, a NET component, can perturb the interaction between the SARS-CoV-2 spike protein and its ACE2 receptor, which mediates viral entry into cells. At present, however, the levels of cathelicidin antimicrobial peptides after SARS-CoV-2 infection and their role in COVID-19 thrombosis formation remain unclear. In the current study, we analyzed coagulation function and found a decrease in thrombin time but an increase in fibrinogen level, prothrombin time, and activated partial thromboplastin time in COVID-19 patients. In addition, the cathelicidin antimicrobial peptide LL-37 was upregulated by the spike protein and significantly elevated in the plasma of patients. Furthermore, LL-37 levels were negatively correlated with thrombin time but positively correlated with fibrinogen level. In addition to platelet activation, cathelicidin peptides enhanced the activity of coagulation factors, such as factor Xa (FXa) and thrombin, which may induce hypercoagulation in diseases with high cathelicidin peptide levels. Injection of cathelicidin peptides promoted the formation of thrombosis, whereas deletion of cathelicidin inhibited thrombosis in vivo. These results suggest that cathelicidin antimicrobial peptide LL-37 is elevated during SARS-CoV-2 infection, which may induce hypercoagulation in COVID-19 patients by activating coagulation factors.
Similar content being viewed by others
Avoid common mistakes on your manuscript.
Introduction
SARS-CoV-2 is the causative pathogen of coronavirus disease 2019 (COVID-19), a potentially life-threatening multi-organ disease that continues to impact the human population on a global scale. Accumulating evidence indicates that frequent thromboembolic complications affecting the venous and arterial vascular systems are an important risk factor in patients with COVID-19 [1,2,3,4,5,6,7,8,9,10]. Vascular complications caused by dysfunctional coagulation include venous thromboembolism (VTE), a composite of deep vein thrombosis (DVT) and pulmonary embolism (PE) [11,12,13,14,15,16]. Current evidence suggests that the incidence of thrombotic complications in COVID-19 patients admitted to intensive care units (ICUs) is between 16 and 49% [6,7,8, 10,11,12, 15]. Small thrombi have also been observed in the pulmonary arterioles of COVID-19 patients during autopsy [17, 18]. Basic characteristics of hypercoagulation, including d-dimers and fibrinogen elevation, platelet activation, and platelet-monocyte aggregate formation, are also found in critically ill COVID-19 patients, and is known as a coagulation storm [6,7,8, 16, 19,20,21,22,23]. The prophylactic use of low-molecular weight heparin (LMWH) is recommended in all hospitalized patients for anti-thrombosis, unless contraindicated [1, 11, 20]. Despite the presence of hypercoagulation, unexplained prolongation of activated partial thromboplastin time (APTT) and prothrombin time (PT) has also been reported in COVID-19 patients [24, 25]. At present, however, the factors that induce the above hematological findings in COVID-19 remain elusive.
Circulating markers of neutrophil extracellular traps (NETs), such as nucleosomal citrullinated histone H3 (H3Cit-DNA), cell-free DNA (cfDNA), and neutrophil elastase (NE), are increased in COVID-19 patients and NETs are known to contribute to immunothrombosis in COVID-19 acute respiratory distress syndrome [26,27,28]. Cathelicidin antimicrobial peptides, components of NETs [29], are reported to perturb the interaction between SARS-CoV-2 spike protein and its ACE2 receptor [30], which may inhibit viral infection. However, the levels of cathelicidin antimicrobial peptides and their role in the thrombosis formation in COVID-19 patients remain unclear.
Cathelicidins, which belong to the family of host defense peptides, play an important role in innate immunity [31]. They exhibit a broad-spectrum effect against pathogens via direct microbicidal and immunomodulatory activities [32]. LL-37 is the only human member of the cathelicidin antimicrobial peptide family and is derived from human cathelicidin antimicrobial protein 18 (hCAP18) by the cleavage of proteinase 3 [33]. Although cathelicidins have mostly been studied with respect to their antibacterial and immunomodulatory activity, elevated levels are reported to aggravate diseases, such as psoriasis [34], atherosclerosis [35] and ulcerative colitis [36], by induction of inflammation. Cathelicidins may initiate and propagate thrombosis by activating platelets [37, 38]; however, their role in coagulation cascade activation remains unclear.
Here, we investigated the role of LL-37 in COVID-19 patient coagulopathy. Results showed that increased LL-37 was correlated with COVID-19-related coagulation dysfunction. LL-37 may potentiate the activity of coagulation factors, such as FXa and thrombin, thereby contributing to hypercoagulation in COVID-19.
Methods
Experimental ethics
All human specimens and clinical information were collected with informed consent of the patients prior to the study from the Chongqing Public Health Medical Center (CPHMC) and Department of Infectious Diseases, Southwest Hospital, Third Military Medical University (Army Medial University). Patients with laboratory-confirmed COVID-19 (n = 62) and age- and sex-matched healthy controls (HCs, n = 21) were included in this study. For the measurement of LL-37, thrombin time (TT), fibrinogen, prothrombin time (PT) and activated partial thromboplastin time (APTT), numbers of each group indicated in the text. COVID-19 patients were divided into mild or moderate (MM, n = 40) and severe or critical (SC, n = 22) groups according to the Chinese Clinical Guidance for COVID-19 Pneumonia Diagnosis and Treatment (6th edition). Briefly, patients with mild or moderate (MM) disease were defined based on the following clinical symptoms: (1) Mild clinical symptoms, with no sign of pneumonia on chest imaging; (2) Fever and respiratory symptoms, with signs of pneumonia through radiological assessment. Patients with severe or critical (SC) disease were defined based on the following clinical symptoms: (1) Shortness of breath, respiratory rate (RR) ≥ 30 times/min, oxygen saturation ≤ 93% at rest, alveolar oxygen partial pressure/fraction of inspiration O2 (PaO2/FiO2) ≤ 300 mmHg; (2) Respiratory failure requiring mechanical ventilation, shock, combined with other organ failure needed ICU monitoring and treatment. Determination of LL-37 in the plasma of COVID-19 patients and HCs was approved by the Ethics Committee of Chongqing Public Health Medical Center (2020-002-01-KY, 2020-003-01-KY). The study and all animal experiments were approved by the Institutional Review Board and Animal Care and Use Committee at Kunming Institute of Zoology (SMKX-20201021-15).
Reagents
Reagents were purchased from Sigma-Aldrich or indicated suppliers. Anti-β-actin mouse (sc-47778) and anti-LL-37 mouse monoclonal antibodies (sc-166770) were purchased from Santa Cruz Biotechnology. Anti-cathelicidin rabbit monoclonal antibodies (ab207758) were purchased from Abcam. Peroxidase-AffiniPure goat anti-rabbit IgG (111-035-003), peroxidase-AffiniPure goat anti-mouse IgG (115-035-003), and fluorescein (FITC)-AffiniPure donkey anti-mouse IgG (715-095-151) were purchased from Jackson ImmunoResearch Laboratories. The SARS-CoV-2 spike protein (Z03481) was purchased from GenScript. Human alpha thrombin (HT 1002a) and human factor Xa (HFXa 1011) were purchased from Enzyme Research Laboratories.
Peptide synthesis
Peptides (LL-37: [LL-37, 37 aa]; Cramp: GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE; and FITC-labeled LL37 or FITC-labeled Cramp) were synthesized by GL Biochem (Shanghai, China) and their purities (> 98%) were confirmed by reversed phase high-performance liquid chromatography (RP-HPLC) and mass spectrometry.
Mice
Male C57BL/6 J mice aged 6–8 weeks were purchased from Beijing HFK Bio-Technology Co. Ltd. (Beijing, China). Cramp knockout mice (Cramp−/−) were purchased from the Jackson Laboratory.
Cell culture and treatment
The human lung epithelial cell line A549 was purchased from the Kunming Cell Bank and maintained in complete Dulbecco’s Modified Eagle Medium (Corning, 10-013-CVR) supplemented with 10% fetal bovine serum, 100 U/ml penicillin, and 100 μg/ml streptomycin (Gibco BRL, Gaithersburg, MD, USA) at 37 °C in 5% CO2.
To determine the effects of SARS-CoV-2 infection on LL-37 expression, A549 cells were stimulated with SARS-CoV-2 (MOI: 0.01, 0.05, 0.25) for 2 h at the biosafety level-3 laboratory of the Kunming High-level Biosafety Primate Research Center, Yunnan, China, with LL-37 expression then detected using confocal microscopy and enzyme linked immunosorbent assay (ELISA) after 24 h. To confirm whether the effects of SARS-CoV-2 on LL-37 expression were dependent on the spike protein, we stimulated A549 cells with spike protein (0.4–10 μg/ml), bovine serum albumin (BSA, 10 μg/ml, negative control), lipopolysaccharides (LPS, positive control) from Escherichia coli O111:B4 (10 μg/ml) for 24 h, then measured LL-37 expression using confocal microscopy and Western blot analysis.
ELISA
The levels of LL-37 in the plasma of COVID-19 patients and supernatant of SARS-CoV-2 stimulated A549 cells were analyzed using a LL-37 ELISA kit (Hycult Biotech, HK321-01) according to the manufacturer’s instructions. A binding assay between cardiolipin and LL-37 was carried out by ELISA according to previously described methods [39]. Briefly, a 96-well white plate (Corning, Kennebunk ME, USA) was filled with 50 μl of 50 μg/ml cardiolipin diluted in ethanol and evaporated at 4 °C. After washing with phosphate-buffered saline (PBS; pH 7.4), the wells were blocked with 2% BSA in PBS (1 h at room temperature). Then, 100 μl of FITC-labeled LL-37 or FITC-labeled Cramp (10 μg/ml) was added, followed by incubation for 1 h at 37 °C. After washing with PBS (pH 7.4), fluorescence was detected using a Cytation 3 Cell Imaging Multi-Mode Reader (Biotek), and the binding of LL-37 with cardiolipin was calculated. In all assays, ethanol-treated wells were used as negative controls.
Western blot analysis
After stimulation with the SARS-CoV-2 spike protein (0.4–10 μg/ml) for 24 h, A549 cells were homogenized and sonicated in RIPA buffer (Sigma: 150 mM NaCl, 1.0% IGEPAL® CA-630, 0.5% sodium deoxycholate, 0.1% sodium dodecyl sulfate (SDS), 50 mM Tris, pH 8.0). Insoluble material was removed by centrifugation (12 000 rpm, 4 ℃, 15 min). The cell homogenates were separated by tricine SDS–polyacrylamide gel electrophoresis (tricine-SDS-PAGE), then transferred to polyvinylidene difluoride (PVDF) membranes (Rainin, 0.22 μm). Anti-cathelicidin (ab207758) and anti-β-actin antibodies were used to detect cathelicidin and β-actin according to the manufacturer’s instructions.
Coagulation functional assay and enzymatic activity assay of coagulation factors
Coagulation function assays (TT, APTT, PT) were conducted by detecting absorbance at 650 nm using the SUNBIO kit according to the manufacturer’s instructions. Enzymatic activity of coagulation factors was measured using chromogenic substrate. Briefly, coagulation factors (FXa, 0.1 nM, thrombin, 10 nM) and different amounts of peptides (final concentrations ranging from 0.0 to 16.2 μg/ml) were pre-incubated for 10 min at 37 °C. After incubation, the reaction was initiated by the addition of 0.5 mM substrate F3301 (CH3OCO-D-CHA-Gly-Arg-pNA-AcOH, Sigma) for FXa and H-D-Phe-Pip-Arg-pNa·2HCl (Hyphen Biomed, Neuville-sur-Oise, France) for thrombin, with the reaction monitored continuously at 405 nm.
To confirm the effects of cathelicidins on coagulation factors, we determined the role of LL-37 and Cramp on enzymatic activity of thrombin and FXa to their physiological substrates (fibrinogen and prothrombin, respectively). Briefly, LL-37 (0–50 μg/ml) or Cramp (0–50 μg/ml) was incubated with thrombin (5 nM in buffer: 100 mM NaCl, 50 mM Tris, 5 mM CaCl2, pH 8.0) and FXa (200 nM, in buffer: 100 mM NaCl, 50 mM Tris, 5 mM CaCl2, pH 8.0) for 10 min at 37 °C, respectively. Their physiological substrates, i.e., fibrinogen (2 μM) and prothrombin (10 μM), were added and incubated for another 10, 30 min at 37 °C, respectively. After that, reduced loading buffer was added and boiled for 5 min, and the samples were analyzed by SDS-PAGE and stained using Coomassie Blue.
To determine the enzymatic activity of thrombin and FXa in plasma from Cramp knockout (Cramp−/−) and C57BL/6 J mice (n = 6–7 per group), thrombin and FXa chromogenic substrates were added to the plasma, with the reaction initiated immediately and monitored continuously at 405 nm.
Surface plasmon resonance (SPR) analysis
SPR analysis was performed as described previously, with some modifications [40]. Briefly, thrombin and FXa were immobilized on the activated sensor chip CM-5 by amine coupling. LL-37 or Cramp in HBS-EP + running buffer was applied to the immobilized ligand at a flow rate of 30 μl/min and the real-time binding signal was recorded using BIAcore 3000 (GE, USA). The equilibrium dissociation constant (KD) was calculated using the Langmuir model with Biacore evaluation software provided by the manufacturer.
FeCl 3 -induced mouse thrombosis model
Male C57BL/6 mice with or without cathelicidin antimicrobial peptides administration and Cramp−/− mice (6–8 weeks old, n = 3–7 per group) were anesthetized with 2% isoflurane. The left carotid artery was exposed and visualized through a dissecting microscope. A Doppler microvascular probe (RWD Life Science, Shenzhen, China) was placed on the exposed artery to measure vascular blood flow. Thrombosis was induced by directly placing a small piece of filter paper saturated with 20% FeCl3 on the artery for 1.5 min. Time to vessel occlusion was measured when blood flow was completely stopped.
Acute pulmonary thromboembolism in mice
LL-37 (100 μl, 30 mg/kg) or Cramp (100 μl, 30 mg/kg) in saline was injected into male C57BL/6 mice (6–8 weeks old, n = 5 per group) via the caudal vein. Control mice received the same volume of saline. At 10 min after the injection, the mice were anesthetized with pentobarbital sodium (50 mg/kg, intraperitoneal injection). The chest cavity was then exposed, and the right side of the heart was perfused with saline to remove blood from pulmonary circulation. After perfusion, the whole lung was excised and fixed in 4% paraformaldehyde dissolved in PBS at 4 °C overnight for histopathological examination.
Confocal microscopy
For immunostaining, cells were fixed in 4% paraformaldehyde and PBS at 4 °C for 30 min and permeabilized with 0.1% Triton X-100 in PBS for 15 min before being treated with 2% BSA for 1 h at 25 °C. To analyze LL-37 expression in A549 cells, samples were incubated with anti-LL-37 mouse monoclonal antibodies (sc-166770). DAPI (1 μg/ml, Roche Diagnostics) was used to stain DNA. After washing with PBS, cells were incubated for 1 h at 37 °C with fluorescent-labeled fluorescein (FITC)-AffiniPure donkey anti-mouse IgG secondary antibodies (715-095-151). Cells were imaged using an Olympus FluoView 1000 confocal microscope (Olympus, Melville, NY, USA).
Statistical evaluation
Data obtained from independent experiments were presented as mean ± standard deviation (SD). For normal continuous variables, one-way analysis of variance (ANOVA) was used. Comparisons of more than two groups were performed using Kruskal–Wallis one-way ANOVA followed by Dunn’s multiple comparison test using GraphPad Prism v5. Differences were considered significant at p < 0.05.
Results
Coagulation function in COVID-19 patients
To assess coagulation function in COVID-19 patients, coagulation testing (TT, PT, APTT, fibrinogen) was performed. As illustrated in Fig. 1A, B, TT (HCs vs MM vs SC: 17.96 ± 0.98 s vs 14.60 ± 0.79 s vs 15.43 ± 1.37 s) was shortened and fibrinogen (HCs vs MM vs SC: 2.81 ± 0.48 g/L vs 4.21 ± 0.83 g/L vs 4.81 ± 0.98 g/L) was increased in COVID-19 patients compared to HCs. Both MM and SC patients showed significantly shortened TT and increased fibrinogen, suggesting hypercoagulation in COVID-19 patients. However, PT showed no significant difference between COVID-19 patients (MM: 12.00 ± 0.80 s, SC: 12.06 ± 1.29 s) and HCs (11.53 ± 0.52 s) (Fig. 1C), while APTT (Fig. 1D) was elevated in COVID-19 patients (MM: 41.35 ± 4.48 s and SC: 38.70 ± 9.63 s) compared to HCs (29.44 ± 3.52 s), which are contradictory to the shortened TT and increased fibrinogen level. These results suggest that certain factors exist in the blood of COVID-19 patients, which could affect PT and APTT.
Elevated LL-37 in plasma of COVID-19 patients
Cathelicidin peptides increase during viral infection, which induces the formation of thrombosis by activating platelets [37, 38]. The human cathelicidin antimicrobial peptide LL-37 is reported to inhibit SARS-CoV-2 infection [30]. To investigate the role of cathelicidin peptides in SARS-CoV-2 infection, the level of LL-37 in the plasma of COVID-19 patients (MM and SC) and HCs was measured. As illustrated in Fig. 2A, the concentration of LL-37 in the plasma of COVID-19 patients (140 ± 46.47 ng/ml in MM and 147.6 ± 64.24 ng/ml in SC) was significantly higher than that in HCs (93.62 ± 48.14 ng/ml).
SARS-CoV-2 upregulates LL-37 expression through the spike protein
To further investigate the association between LL-37 overexpression and SARS-CoV-2 infection, the expression of hCAP18 (precursor of LL-37) in A549 cells after SARS-CoV-2 spike protein (0.4–10 μg/ml) incubation for 24 h at 37 ℃ was determined by Western blot analysis. From the results of Fig. 2B, hCAP18 expression in A549 cells significantly increased after incubation with the spike protein. To further confirm the effects of the spike protein on LL-37 expression, we stimulated A549 cells with spike protein (0.4–10 μg/ml), BSA (10 μg/ml, negative control), LPS (positive control) from Escherichia coli O111:B4 (10 μg/ml) for 24 h, then measured LL-37 expression by confocal microscopy. As illustrated in Fig. 2C, BSA had no effect on LL-37 expression, whereas the spike protein and LPS significantly promoted LL-37 expression. Furthermore, to confirm the effects of SARS-CoV-2 infection on LL-37 expression, we stimulated A549 cells with SARS-CoV-2 (MOI: 0.01, 0.05, 0.25) for 2 h, then detected LL-37 expression using confocal microscopy and ELISA after 24 h. As illustrated in Fig. 2D, E, SARS-CoV-2 infection significantly elevated LL-37 expression. Thus, these results suggest that SARS-CoV-2 infection induced LL-37 expression through the spike protein.
LL-37 is correlated with coagulation function in COVID-19 patients
As LL-37 expression and coagulation function changed in COVID-19 patients, we investigated the correlations between LL-37 and TT, fibrinogen, PT, and APTT. As shown in Fig. 3A–D, LL-37 was negatively correlated with TT (Fig. 3A, R2 = 0.1082, p = 0.0045) and positively correlated with fibrinogen level (Fig. 3B, R2 = 0.0894, p = 0.0097) and APTT (Fig. 3D, R2 = 0.1046, p = 0.0053), but showed no correlation with PT (Fig. 3C, R2 = 0.0195, p = 0.2392).
LL-37 promotes thrombosis formation through potentiation of coagulation factor activity
As LL-37 was correlated with TT and fibrinogen, the effects of LL-37 on coagulation factor activity were determined. Based on the chromogenic substrate assay, LL-37 enhanced the activity of thrombin (Fig. 4A) and FXa (Fig. 4B) in a dose-dependent manner. SPR was conducted to analyze the binding capacity of LL-37 with thrombin and FXa. As illustrated in Fig. S1A, S1B, LL-37 could bind to thrombin and FXa, with KD values of 2.64 × 10–6 M and 8.47 × 10–7 M, respectively. We also measured the effects of LL-37 on thrombin and FXa to their physiological substrates. After the reactions of thrombin or FXa with fibrinogen or prothrombin in the presence of cathelicidin peptides (0–50 μg/ml), the samples were separated by SDS-PAGE and analyzed using Coomassie Blue. Similar to the chromogenic substrate assay, LL-37 enhanced the activity of thrombin and FXa against their physiological substrates, fibrinogen (Fig. 4C) and prothrombin (Fig. 4D), respectively.
Given the effect of LL-37 on thrombin and FXa, we further investigated the effects of cathelicidin on thrombosis formation in vivo. As seen in Fig. 4E, LL-37 significantly promoted thrombosis formation and shortened the time of arterial occlusion in the FeCl3-induced carotid artery thrombosis mouse model. LL-37 administration also induced lung thrombosis directly (Fig. 4G).
Cramp promotes thrombosis formation through promotion of coagulation factor activity
To confirm the effects of LL-37 on thrombosis formation through activation of coagulation factors, we detected the effects of Cramp (LL-37 homolog from Mus musculus) on coagulation factor activation. Similar to the LL-37 results, the chromogenic substrate assay showed that Cramp significantly enhanced the enzymatic activity of thrombin (Fig. 5A) and FXa (Fig. 5B) in a dose-dependent manner. SPR analysis also indicated interactions of Cramp with thrombin (Fig. S1C) and FXa (Fig. S1D), with KD values of 6.78 × 10–6 M and 3.17 × 10–4 M, respectively. Based on the KD results, the binding capacity of LL-37 with coagulation factors was higher than that of Cramp. The results of thrombin and FXa on their natural substrates (fibrinogen and prothrombin) confirmed that Cramp promoted the enzymatic activity of thrombin (Fig. 5C) and FXa (Fig. 5D).
Furthermore, plasma from Cramp−/− mice showed weaker thrombin (Fig. 5E) and FXa activity (Fig. 5F) on chromogenic substrates than plasma from wild-type C57BL/6 mice, suggesting that Cramp deletion attenuated thrombin and FXa activity.
Similar to the LL-37 results, Cramp administration significantly enhanced lung thrombosis in acute pulmonary thromboembolism mouse model (Fig. 5G) and shortened the time of arterial occlusion in the FeCl3-induced carotid artery thrombosis mouse model (Fig. 5H). Furthermore, Cramp deletion was resistant to arterial occlusion in the FeCl3-induced carotid artery thrombosis mouse model (Fig. 5I).
LL-37 and Cramp show similar effects on PT and APTT in COVID-19 patients.
LL-37 and Cramp enhanced coagulation factor (thrombin and FXa) activity, which should shorten PT and APTT. However, LL-37 had no effect on PT (Fig. S2A) and prolonged APTT (Fig. S2B) at higher concentrations. Somewhat inconsistent with LL-37, Cramp prolonged PT (Fig. S2C) and APTT (Fig. S2D) in a dose-dependent manner. Thus, these findings were contradictory to expectation, but were consistent with the PT and APTT values found in COVID-19 patients.
Basic histone, which can induce hypercoagulation, prolongs PT and APTT by binding with phospholipids [41], suggesting that basic LL-37 or Cramp may prolong PT and APTT through interaction with phospholipids. Indeed, based on the ELISA results, LL-37 and Cramp could bind with cardiolipin (Fig. S3A).Furthermore, we detected the effects of pre-incubation with cardiolipin on cathelicidin peptide-induced PT/APTT prolongation. LL-37 induced PT prolongation tendency at concentration of 25 μM, which could be inhibited by pre-incubation with cardiolipin (Fig. S3B). In addition, LL-37-induced APTT prolongation was significantly inhibited by cardiolipin pre-incubation (Fig. S3C). Similar to LL-37, pre-incubation with cardiolipin significantly abolished Cramp-induced PT (Fig. S3D) and APTT (Fig. S3E) prolongation. From these results, PT/APTT prolongation induced by LL-37 or Cramp may be caused by interactions with phospholipids, which can inhibited by the pre-incubation with cardiolipin.
Discussion
To the best of our knowledge, this is the first study to report on the correlation between elevated LL-37 levels and hypercoagulation in COVID-19 patients. LL-37 was upregulated by SARS-CoV-2 infection to cause elevated concentration in the plasma of COVID-19 patients and showed the ability to directly activate coagulation factors. The upregulation of LL-37 was associated with clinical hypercoagulation manifestations induced by SARS-CoV-2 infection and likely contributes to the hypercoagulation frequently observed in COVID-19 patients (Fig. 6).
Hypercoagulability has been reported as a central pathological feature and clinical complication in COVID-19 [10]. It is likely that multiple systems contribute to thrombosis in COVID-19 patients, such as coagulation activation, platelet activation, hypofibrinolysis, endothelial cell dysfunction, inflammation, NETs, and complement [42]. Platelet activation and platelet-monocyte aggregate formation trigger tissue factor expression in patients with severe COVID-19 [43]. NETs are also known to contribute to immunothrombosis in COVID-19 acute respiratory distress syndrome [27]. Here, we showed that LL-37 induced hypercoagulability through enhancement of coagulation factor activity. LL-37 has also been found to induce endothelial cell dysfunction, inflammation, NETs formation, platelet activation, which may promote thrombosis in COVID-19.
The hCAP18 protein contains a conserved cathelin-like domain and a highly variable C-terminal peptide (LL-37). The cathelin-like domain of the cathelicidin is classified into the same superfamily as cystatins, the cysteine protease inhibitors, and the cathelin-like domain of hCAP18 can inhibit cathepsin L activity [44]. Although few studies have explored the function of the cathelicidin C-terminal peptide on protease activity, a recent study on cathelicidin-MH (cath-MH) from the skin of Microhyla heymonsivogt frog was found to suppress coagulation by affecting enzymatic activities [45], inconsistent with the effects of LL-37. Through sequence alignment analysis, LL-37 displays low sequence identity with cath-MH and lacks the loop formed by the intramolecular disulfide bond [45], which may explain their discrepancy in coagulation factor activity.
Disseminated intravascular coagulopathy (DIC) has been reported in COVID-19 patients [46]. In addition, consistent with classic DIC caused by bacterial sepsis, prolonged APTT, thrombocytopenia, elevated D-dimer, and multi-organ microangiopathic thrombosis have also been found in COVID-19 patients. The prolongation of APTT is difficult to explain, but our results suggest it may be induced by elevated LL-37. Notably, LL-37 activates the thrombin and FXa coagulation factors, leading to hypercoagulability, with the binding of phospholipids likely prolonging APTT.
As a major family of antimicrobial peptides, cathelicidin peptides are expressed over a broad range of sites during infection and inflammation, and are primarily generated by neutrophils and epithelial cells [47]. Elevated cathelicidins form part of the body’s defense against pathogens, with the antiviral activity of cathelicidin peptides reported in many viruses e.g., human immunodeficiency virus (HIV)-1 [48], influenza A virus (IAV) [31, 49], respiratory syncytial virus (RSV) [47], rhinovirus (HRV) [50], vaccinia virus (VACV) [51], herpes simplex virus (HSV) [52], zika virus (ZIKV) [53], dengue virus (DENV) [54] and hepatitis C virus (HCV) [55]. Recently, research reported the inhibition of LL-37 on SARS-CoV-2 infection using biochemical and pseudovirus entry assays [30]. While, the direct effects of LL-37 on SARS-CoV-2 remain unclear. Here we found LL-37 induced hypercoagulation through the potentiation of coagulation factor activities, which was consistent with the clinical symptoms of COVID-19 patients. Moreover, elevated LL-37 has been found to activate platelets. Therefore, although the elevation of LL-37 during SARS-CoV-2 infection may be a protective mechanism of the innate immune system, the increase in LL-37 may also aggravate disease progress by inducing thrombosis, which may explain the controversy of vitamin D (inducer of LL-37 production) treatment in COVID-19 [56].
In addition to its antimicrobial activity, LL-37 also exhibits various biological effects, such as regulation of inflammation, cell proliferation and apoptosis. However, overexpression of LL-37 or LL-37 complexes with other molecules may contribute to progression of diseases. For example, the LL-37-DNA/RNA complex can aggravate psoriasis [34, 57], atherosclerosis [35, 58], ulcerative colitis [36], sepsis [59], thrombosis [37], and chronic obstructive pulmonary disease [60] through the induction of inflammation. Cytokine storms are another clinical marker of SARS-CoV-2, which induce higher morbidity and mortality in COVID-19 patients [61]. Circulating cell-free DNA [62], cell-free mitochondrial DNA [63], and cell-free microbial DNA [64] are increased in SARS-CoV-2 infection and are associated with disease severity and mortality in COVID-19 patients. Therefore, elevated LL-37 may induce the inflammation via interactions with increased cell-free DNA of COVID-19 patients, thereby exacerbating disease process.
In conclusion, we observed a close correlation between LL-37 and the hypercoagulation frequently observed in COVID-19 patients. The level of LL-37 was increased in the plasma of COVID-19 patients with the induction of SARS-CoV-2 spike protein. Elevated LL-37 may contribute to thrombosis via potentiation of coagulation factor activity. As the results of our research, although LL-37 has been found to perturb SARS-CoV-2 infection, it is not suitable for the treatment of SARS-CoV-2 infection, especially for patients in hypercoagulability.
Data availability
Data are available on request from the corresponding author.
References
Ortiz-Muñoz G, Yu MA, Lefrançais E, Mallavia B, Valet C, Tian JJ, Ranucci S, Wang KM, Liu Z, Kwaan N, Dawson D, Kleinhenz ME, Khasawneh FT, Haggie PM, Verkman AS, Looney MR (2020) Cystic fibrosis transmembrane conductance regulator dysfunction in platelets drives lung hyperinflammation. J Clin Investig 130:2041–2053
Akel T, Qaqa F, Abuarqoub A, Shamoon F (2020) Pulmonary embolism: a complication of COVID 19 infection. Thromb Res 193:79–82
Tamburello A, Bruno G, Marando M (2020) COVID-19 and pulmonary embolism: not a coincidence. Eur J Case Rep Intern Med 7:001692
Carbone F, Montecucco F, Twickler T (2020) SARS-CoV-2: what is known and what there is to know–focus on coagulation and lipids. European J Clin Invest 50:e13311
Poor HD, Ventetuolo CE, Tolbert T, Chun G, Serrao G, Zeidman A, Dangayach NS, Olin J, Kohli-Seth R, Powell CA (2020) COVID-19 critical illness pathophysiology driven by diffuse pulmonary thrombi and pulmonary endothelial dysfunction responsive to thrombolysis. Clin Transl Med 10:e44
Wang J, Saguner AM, An J, Ning Y, Yan Y, Li G (2020) Dysfunctional coagulation in COVID-19: from cell to bedside. Adv Ther 37:1–7
Al-Samkari H, Karp Leaf RS, Dzik WH, Carlson JC, Fogerty AE, Waheed A, Goodarzi K, Bendapudi P, Bornikova L, Gupta S, Leaf D, Kuter DJ, Rosovsky RP (2020) COVID and coagulation: bleeding and thrombotic manifestations of sars-cov2 infection. Blood. https://doi.org/10.1182/blood.2020006520
Lemke G, Silverman GJ (2020) Blood clots and TAM receptor signalling in COVID-19 pathogenesis. Nat Rev Immunol 20:1–2
Lorenzo C, Francesca B, Francesco P, Elena C, Luca S, Paolo S (2020) Acute pulmonary embolism in COVID-19 related hypercoagulability. J Thromb Thrombolysis 50:223–226
Levi M, Thachil J, Iba T, Levy JH (2020) Coagulation abnormalities and thrombosis in patients with COVID-19. Lancet Haematol 7:e438–e440
Coppola A, Lombardi M, Tassoni MI, Carolla G, Tala M, Morandini R, Paoletti O, Testa S (2020) COVID-19, thromboembolic risk and thromboprophylaxis: learning lessons from the bedside, awaiting evidence. Blood Transfus 18:226–229
Willyard C (2020) Coronavirus blood-clot mystery intensifies. Nature 581:250
Middeldorp S, Coppens M, van Haaps TF, Foppen M, Vlaar AP, Müller MCA, Bouman CCS, Beenen LFM, Kootte RS, Heijmans J, Smits LP, Bonta PI, van Es N (2020) Incidence of venous thromboembolism in hospitalized patients with COVID-19. J Thromb Haemost 18:1995–2002
Helms J, Tacquard C, Severac F, Leonard-Lorant I, Ohana M, Delabranche X, Merdji H, Clere-Jehl R, Schenck M, Fagot Gandet F, Fafi-Kremer S, Castelain V, Schneider F, Grunebaum L, Anglés-Cano E, Sattler L, Mertes PM, Meziani F (2020) High risk of thrombosis in patients with severe SARS-CoV-2 infection: a multicenter prospective cohort study. Intensive Care Med 46:1089–1098
Connors JM, Levy JH (2020) COVID-19 and its implications for thrombosis and anticoagulation. Blood 135:2033–2040
Zhang L, Yan X, Fan Q, Liu H, Liu X, Liu Z, Zhang Z (2020) D-dimer levels on admission to predict in-hospital mortality in patients with Covid-19. J Thromb Haemost 18:1324–1329
Fox SE, Akmatbekov A, Harbert JL, Li G, Quincy Brown J, Vander Heide RS (2020) Pulmonary and cardiac pathology in African American patients with COVID-19: an autopsy series from New Orleans. Lancet Respir Med 8:681–686
Wichmann D, Sperhake JP, Lütgehetmann M, Steurer S, Edler C, Heinemann A, Heinrich F, Mushumba H, Kniep I, Schröder AS, Burdelski C, de Heer G, Nierhaus A, Frings D, Pfefferle S, Becker H, Bredereke-Wiedling H, de Weerth A, Paschen HR, Sheikhzadeh-Eggers S, Stang A, Schmiedel S, Bokemeyer C, Addo MM, Aepfelbacher M, Püschel K, Kluge S (2020) Autopsy findings and venous thromboembolism in patients with COVID-19: a prospective cohort study. Ann Intern Med 173:268–277
Xiong M, Liang X, Wei YD (2020) Changes in blood coagulation in patients with severe coronavirus disease 2019 (COVID-19): a meta-analysis. Br J Haematol 189:1050–1052
Kollias A, Kyriakoulis KG, Dimakakos E, Poulakou G, Stergiou GS, Syrigos K (2020) Thromboembolic risk and anticoagulant therapy in COVID-19 patients: emerging evidence and call for action. Br J Haematol 189:846–847
Dolhnikoff M, Duarte-Neto AN, de Almeida Monteiro RA, da Silva LFF, de Oliveira EP, Saldiva PHN, Mauad T, Negri EM (2020) Pathological evidence of pulmonary thrombotic phenomena in severe COVID-19. J Thromb Haemost 18:1517–1519
Zhang Y, Xiao M, Zhang S, Xia P, Cao W, Jiang W, Chen H, Ding X, Zhao H, Zhang H, Wang C, Zhao J, Sun X, Tian R, Wu W, Wu D, Ma J, Chen Y, Zhang D, Xie J, Yan X, Zhou X, Liu Z, Wang J, Du B, Qin Y, Gao P, Qin X, Xu Y, Zhang W, Li T, Zhang F, Zhao Y, Li Y, Zhang S (2020) coagulopathy and antiphospholipid antibodies in patients with COVID-19. N Engl J Med 382:e38
Tang N, Li D, Wang X, Sun Z (2020) Abnormal coagulation parameters are associated with poor prognosis in patients with novel coronavirus pneumonia. J Thromb Haemost 18:844–847
Terpos E, Ntanasis-Stathopoulos I, Elalamy I, Kastritis E, Sergentanis TN, Politou M, Psaltopoulou T, Gerotziafas G, Dimopoulos MA (2020) Hematological findings and complications of COVID-19. Am J Hematol 95:834–847
Pineton de Chambrun M, Frere C, Miyara M, Amoura Z, Martin-Toutain I, Mathian A, Hekimian G, Combes A (2021) High frequency of antiphospholipid antibodies in critically ill COVID-19 patients: a link with hypercoagulability? J Intern Med 289:422–424
Ng H, Havervall S, Rosell A, Aguilera K, Parv K, von Meijenfeldt FA, Lisman T, Mackman N, Thålin C, Phillipson M (2021) Circulating markers of neutrophil extracellular traps are of prognostic value in patients with COVID-19. Arterioscler Thromb Vasc Biol 41:988–994
Middleton EA, He XY, Denorme F, Campbell RA, Ng D, Salvatore SP, Mostyka M, Baxter-Stoltzfus A, Borczuk AC, Loda M, Cody MJ, Manne BK, Portier I, Harris ES, Petrey AC, Beswick EJ, Caulin AF, Iovino A, Abegglen LM, Weyrich AS, Rondina MT, Egeblad M, Schiffman JD, Yost CC (2020) Neutrophil extracellular traps contribute to immunothrombosis in COVID-19 acute respiratory distress syndrome. Blood 136:1169–1179
Barnes BJ, Adrover JM, Baxter-Stoltzfus A, Borczuk A, Cools-Lartigue J, Crawford JM, Daßler-Plenker J, Guerci P, Huynh C, Knight JS, Loda M, Looney MR, McAllister F, Rayes R, Renaud S, Rousseau S, Salvatore S, Schwartz RE, Spicer JD, Yost CC, Weber A, Zuo Y, Egeblad M (2020) Targeting potential drivers of COVID-19: neutrophil extracellular traps. J Exp Med 217:e20200652
de Buhr N, Reuner F, Neumann A, Stump-Guthier C, Tenenbaum T, Schroten H, Ishikawa H, Müller K, Beineke A, Hennig-Pauka I, Gutsmann T, Valentin-Weigand P, Baums CG, von Köckritz-Blickwede M (2017) Neutrophil extracellular trap formation in the Streptococcus suis-infected cerebrospinal fluid compartment. Cell Microbiol. https://doi.org/10.1111/cmi.12649
Wang C, Wang S, Li D, Chen P, Han S, Zhao G, Chen Y, Zhao J, Xiong J, Qiu J, Wei DQ, Zhao J, Wang J (2021) Human cathelicidin inhibits SARS-CoV-2 infection: killing two birds with one stone. ACS Infect Dis 7:1545–1554
Peng L, Du W, Balhuizen MD, Haagsman HP, de Haan CAM, Veldhuizen EJA (2020) Antiviral activity of chicken cathelicidin B1 against influenza A virus. Front Microbiol 11:426
Bals R, Wilson JM (2003) Cathelicidins—a family of multifunctional antimicrobial peptides. Cell Mol Life Sci 60:711–720
Sørensen OE, Follin P, Johnsen AH, Calafat J, Tjabringa GS, Hiemstra PS, Borregaard N (2001) Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3. Blood 97:3951–3959
Lande R, Gregorio J, Facchinetti V, Chatterjee B, Wang YH, Homey B, Cao W, Wang YH, Su B, Nestle FO, Zal T, Mellman I, Schröder JM, Liu YJ, Gilliet M (2007) Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptide. Nature 449:564–569
Zhang Z, Meng P, Han Y, Shen C, Li B, Hakim MA, Zhang X, Lu Q, Rong M, Lai R (2015) Mitochondrial DNA-LL-37 complex promotes atherosclerosis by escaping from autophagic recognition. Immunity 43:1137–1147
Duan Z, Fang Y, Sun Y, Luan N, Chen X, Chen M, Han Y, Yin Y, Mwangi J, Niu J, Wang K, Miao Y, Zhang Z, Lai R (2018) Antimicrobial peptide LL-37 forms complex with bacterial DNA to facilitate blood translocation of bacterial DNA and aggravate ulcerative colitis. Sci Bulletin 63:1364–1375
Pircher J, Czermak T, Ehrlich A, Eberle C, Gaitzsch E, Margraf A, Grommes J, Saha P, Titova A, Ishikawa-Ankerhold H, Stark K, Petzold T, Stocker T, Weckbach LT, Novotny J, Sperandio M, Nieswandt B, Smith A, Mannell H, Walzog B, Horst D, Soehnlein O, Massberg S, Schulz C (2018) Cathelicidins prime platelets to mediate arterial thrombosis and tissue inflammation. Nat Commun 9:1523
Salamah MF, Ravishankar D, Kodji X, Moraes LA, Williams HF, Vallance TM, Albadawi DA, Vaiyapuri R, Watson K, Gibbins JM, Brain SD, Perretti M, Vaiyapuri S (2018) The endogenous antimicrobial cathelicidin LL37 induces platelet activation and augments thrombus formation. Blood Adv 2:2973–2985
Pereira LF, Marco FM, Boimorto R, Caturla A, Bustos A, De la Concha EG, Subiza JL (1994) Histones interact with anionic phospholipids with high avidity; its relevance for the binding of histone-antihistone immune complexes. Clin Exp Immunol 97:175–180
Jin L, Guo X, Shen C, Hao X, Sun P, Li P, Xu T, Hu C, Rose O, Zhou H, Yang M, Qin CF, Guo J, Peng H, Zhu M, Cheng G, Qi X, Lai R (2018) Salivary factor LTRIN from Aedes aegypti facilitates the transmission of Zika virus by interfering with the lymphotoxin-β receptor. Nat Immunol 19:342–353
Kheiri SA, Fasy TM, Billett HH (1996) Effects of H1 histones and a monoclonal autoantibody to H1 histones on clot formation in vitro: possible implications in the antiphospholipid syndrome. Thromb Res 82:43–50
Mackman N, Antoniak S, Wolberg AS, Kasthuri R, Key NS (2020) Coagulation abnormalities and thrombosis in patients infected with SARS-CoV-2 and other pandemic viruses. Arterioscler Thromb Vasc Biol 40:2033–2044
Hottz ED, Azevedo-Quintanilha IG, Palhinha L, Teixeira L, Barreto EA, Pão CRR, Righy C, Franco S, Souza TML, Kurtz P, Bozza FA, Bozza PT (2020) Platelet activation and platelet-monocyte aggregate formation trigger tissue factor expression in patients with severe COVID-19. Blood 136:1330–1341
Zaiou M, Nizet V, Gallo RL (2003) Antimicrobial and protease inhibitory functions of the human cathelicidin (hCAP18/LL-37) prosequence. J Invest Dermatol 120:810–816
Chai J, Chen X, Ye T, Zeng B, Zeng Q, Wu J, Kascakova B, Martins LA, Prudnikova T, Smatanova IK, Kotsyfakis M, Xu X (2021) Characterization and functional analysis of cathelicidin–MH a novel frog-derived peptide with anti-septicemic properties. eLife 10:e64411
Al-Samkari H, Karp Leaf RS, Dzik WH, Carlson JCT, Fogerty AE, Waheed A, Goodarzi K, Bendapudi PK, Bornikova L, Gupta S, Leaf DE, Kuter DJ, Rosovsky RP (2020) COVID-19 and coagulation: bleeding and thrombotic manifestations of SARS-CoV-2 infection. Blood 136:489–500
Currie SM, Findlay EG, McHugh BJ, Mackellar A, Man T, Macmillan D, Wang H, Fitch PM, Schwarze J, Davidson DJ (2013) The human cathelicidin LL-37 has antiviral activity against respiratory syncytial virus. PLoS ONE 8:e73659
Bergman P, Walter-Jallow L, Broliden K, Agerberth B, Söderlund J (2007) The antimicrobial peptide LL-37 inhibits HIV-1 replication. Curr HIV Res 5:410–415
Tripathi S, Tecle T, Verma A, Crouch E, White M, Hartshorn KL (2013) The human cathelicidin LL-37 inhibits influenza A viruses through a mechanism distinct from that of surfactant protein D or defensins. J Gen Virol 94:40–49
Schögler A, Muster RJ, Kieninger E, Casaulta C, Tapparel C, Jung A, Moeller A, Geiser T, Regamey N, Alves MP (2016) Vitamin D represses rhinovirus replication in cystic fibrosis cells by inducing LL-37. Eur Respir J 47:520–530
Howell MD, Jones JF, Kisich KO, Streib JE, Gallo RL, Leung DY (2004) Selective killing of vaccinia virus by LL-37: implications for eczema vaccinatum. J Immunolog 172:1763–1767
Howell MD, Wollenberg A, Gallo RL, Flaig M, Streib JE, Wong C, Pavicic T, Boguniewicz M, Leung DY (2006) Cathelicidin deficiency predisposes to eczema herpeticum. J Allergy Clin Immunol 117:836–841
Ahmed A, Siman-Tov G, Hall G, Bhalla N, Narayanan A (2019) Human antimicrobial peptides as therapeutics for viral infections. Viruses 11:704
Alagarasu K, Patil PS, Shil P, Seervi M, Kakade MB, Tillu H, Salunke A (2017) In-vitro effect of human cathelicidin antimicrobial peptide LL-37 on dengue virus type 2. Peptides 92:23–30
Matsumura T, Sugiyama N, Murayama A, Yamada N, Shiina M, Asabe S, Wakita T, Imawari M, Kato T (2016) Antimicrobial peptide LL-37 attenuates infection of hepatitis C virus. Hepatol Res 46:924–932
The Lancet Diabetes E. (2021) Vitamin D and COVID-19: why the controversy? Lancet Diabetes Endocrinol 9:53
Lande R, Botti E, Jandus C, Dojcinovic D, Fanelli G, Conrad C, Chamilos G, Feldmeyer L, Marinari B, Chon S, Vence L, Riccieri V, Guillaume P, Navarini AA, Romero P, Costanzo A, Piccolella E, Gilliet M, Frasca L (2014) The antimicrobial peptide LL37 is a T-cell autoantigen in psoriasis. Nat Commun 5:5621
Döring Y, Drechsler M, Wantha S, Kemmerich K, Lievens D, Vijayan S, Gallo RL, Weber C, Soehnlein O (2012) Lack of neutrophil-derived CRAMP reduces atherosclerosis in mice. Circ Res 110:1052–1056
Zuo Y, Dang R, Peng H, Wu Z, Yang Y (2019) LL-37 exacerbates local inflammation in sepsis-induced acute lung injury by preventing mitochondrial DNA (mtDNA) degradation-induced autophagy. Med Sci Monit 25:6193–9203
Persson LJ, Aanerud M, Hardie JA, Miodini Nilsen R, Bakke PS, Eagan TM, Hiemstra PS (2017) Antimicrobial peptide levels are linked to airway inflammation, bacterial colonisation and exacerbations in chronic obstructive pulmonary disease. Eur Respir J 49:1601328
Ye Q, Wang B, Mao J (2020) The pathogenesis and treatment of the ‘Cytokine Storm’ in COVID-19. J Infect 80:607–613
Andargie TE, Tsuji N, Seifuddin F, Jang MK, Yuen PS, Kong H, Tunc I, Singh K, Charya A, Wilkins K, Nathan S, Cox A, Pirooznia M, Star RA, Agbor-Enoh S (2021) Cell-free DNA maps COVID-19 tissue injury and risk of death and can cause tissue injury. JCI Insight 6:e147610
Scozzi D, Cano M, Ma L, Zhou D, Zhu JH, O’Halloran JA, Goss C, Rauseo AM, Liu Z, Sahu SK, Peritore V, Rocco M, Ricci A, Amodeo R, Aimati L, Ibrahim M, Hachem R, Kreisel D, Mudd PA, Kulkarni HS, Gelman AE (2021) Circulating mitochondrial DNA is an early indicator of severe illness and mortality from COVID-19. JCI insight. 6:e143299
Kitsios GD, Bain W, Al-Yousif N, Duttagupta R, Ahmed AA, McVerry BJ, Morris A (2021) Plasma microbial cell-free DNA load is associated with mortality in patients with COVID-19. Respir Res 22:24
Funding
This work was supported by National Natural Science Foundation of China (31930015, 81770464), Chinese Academy of Sciences (SAJC201606, XDB31000000, KFJ-BRP-008) to R.L., National Natural Science Foundation of China (82104130) to N.L., National Natural Science Foundation of China (U2002219) to Z.D., National Natural Science Foundation of China (32002311) to X.C., Chinese Academy of Sciences (XDA12040221, and Youth Innovation Promotion Association (2017432)) to Z.Z., Yunnan Provincial Science and Technology Department (2019FA006, 2019FI014) to Z.Z., Yunnan Provincial Science and Technology Department (2019FB127) to Z.D., Yunnan Provincial Science and Technology Department (202001AT070128) to X.C., Yunnan Provincial Science and Technology Department (202101AU070176) to N.L., PLA Youth Talent Project 17QNP010 and Chongqing Health Commission COVID-19 Project 2020NCPZX01 to G.D.
Author information
Authors and Affiliations
Contributions
Experiments were conceived and designed by ZD, XC, ML and RL Experiments were performed by ZD, JZ, XC, ML, HZ, LJ, ZZ, NL, JW and ZT, JZ, HZ, JW, ZT, PM, YL and GD collected and characterized clinical samples and participated in expression analyses. The paper was written by ZD and R.L. All authors contributed to the discussions.
Corresponding authors
Ethics declarations
Conflict of interest
The authors declare no competing financial interests.
Ethics approval and consent to participate
All human specimens and clinical information were collected with informed consent of the patients prior to the study from the Chongqing Public Health Medical Center (CPHMC) and Department of Infectious Diseases, Southwest Hospital, Third Military Medical University (Army Medial University). Patients with laboratory-confirmed COVID-19 (n = 62) and age- and sex-matched healthy controls (HCs, n = 21) were included in this study. For the measurement of LL-37, thrombin time (TT), fibrinogen, prothrombin time (PT) and activated partial thromboplastin time (APTT), numbers of each group indicated in the text. COVID-19 patients were divided into mild or moderate (MM, n = 40) and severe or critical (SC, n = 22) groups according to the Chinese Clinical Guidance for COVID-19 Pneumonia Diagnosis and Treatment (6th edition). Briefly, patients with mild or moderate (MM) disease were defined based on the following clinical symptoms: 1. Mild clinical symptoms, with no sign of pneumonia on chest imaging; 2. Fever and respiratory symptoms, with signs of pneumonia through radiological assessment. Patients with severe or critical (SC) disease were defined based on the following clinical symptoms: 1. Shortness of breath, respiratory rate (RR) ≥ 30 times/min, oxygen saturation ≤ 93% at rest, alveolar oxygen partial pressure/fraction of inspiration O2 (PaO2/FiO2) ≤ 300 mmHg; 2. Respiratory failure requiring mechanical ventilation, shock, combined with other organ failure needed ICU monitoring and treatment. Determination of LL-37 in the plasma of COVID-19 patients and HCs was approved by the Ethics Committee of Chongqing Public Health Medical Center (2020–002-01-KY, 2020–003-01-KY). The study and all animal experiments were approved by the Institutional Review Board and Animal Care and Use Committee at Kunming Institute of Zoology (SMKX-20201021–15).
Consent for publication
All authors have read and approved the manuscript.
Additional information
Publisher's Note
Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Supplementary Information
Below is the link to the electronic supplementary material.
Rights and permissions
Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/.
About this article
Cite this article
Duan, Z., Zhang, J., Chen, X. et al. Role of LL-37 in thrombotic complications in patients with COVID-19. Cell. Mol. Life Sci. 79, 309 (2022). https://doi.org/10.1007/s00018-022-04309-y
Received:
Revised:
Accepted:
Published:
DOI: https://doi.org/10.1007/s00018-022-04309-y