Abstract
G protein-coupled receptors (GPCRs) are transmembrane signal transducers which regulate many key physiological process. Since their discovery, their analysis has been limited by difficulties in obtaining sufficient amounts of the receptors in high-quality, functional form from heterologous expression hosts. Albeit highly attractive because of its simplicity and the ease of isotope labeling for NMR studies, heterologous expression of functional GPCRs in E. coli has proven particularly challenging due to the absence of the more evolved protein expression and folding machinery of higher eukaryotic hosts. Here we first give an overview on the previous strategies for GPCR E. coli expression and then describe the development of an optimized robust protocol for the E. coli expression and purification of two mutants of the turkey β1-adrenergic receptor (β1AR) uniformly or selectively labeled in 15N or 2H,15N. These mutants had been previously optimized for thermal stability using insect cell expression and used successfully in crystallographic and NMR studies. The same sequences were then used for E. coli expression. Optimization of E. coli expression was achieved by a quantitative analysis of losses of receptor material at each step of the solubilization and purification procedure. Final yields are 0.2–0.3 mg receptor per liter culture. Whereas both expressed mutants are well folded and competent for orthosteric ligand binding, the less stable YY-β1AR mutant also comprises the two native tyrosines Y5.58 and Y7.53, which enable G protein binding. High-quality 1H-15N TROSY spectra were obtained for E. coli-expressed YY-β1AR in three different functional states (antagonist, agonist, and agonist + G protein-mimicking nanobody-bound), which are identical to spectra obtained of the same forms of the receptor expressed in insect cells. NdeI and AgeI restriction sites introduced into the expression plasmid allow for the easy replacement of the receptor gene by other GPCR genes of interest, and the provided quantitative workflow analysis may guide the respective adaptation of the purification protocol.
Similar content being viewed by others
Avoid common mistakes on your manuscript.
Introduction
The more than 800 G protein-coupled receptors (GPCRs) constitute the most abundant class of membrane proteins in the human proteome (Alexander et al. 2017) and also the most important class of human drug targets, with more than 30% of all marketed drugs directed against GPCRs (Hauser et al. 2017). Since their discovery, the production of properly folded, active GPCRs has been the major bottleneck for biochemical, biophysical and structural studies (Tate 2001; Lundstrom et al. 2006; McCusker et al. 2007; Casiraghi et al. 2018). Despite many advances in protein engineering, cloning, expression, and purification technologies, which have led to the experimental elucidation of currently more than 80 distinct GPCR structures, GPCR production in sufficient quantity and quality is still a serious challenge (Wiseman et al. 2020), with low expression levels, low stability, misfolding, aggregation, incorrect disulfide bond formation, and proteolytic degradation being the main impeding factors.
GPCRs have been expressed in many different hosts comprising mammalian cells, insect cells, yeast and E. coli with each system presenting particular advantages and disadvantages [for recent review see (Wiseman et al. 2020)]. The most successful system are baculovirus-infected insect cells, from which about 70% of all solved GPCR structures have been derived (Milić and Veprintsev 2015; Saarenpää et al. 2015; Franke et al. 2018) This success is based on their relative ease of maintenance as compared to mammalian cells, while still harboring the evolved protein translational, folding, membrane insertion, and posttranslational modification mechanisms of higher eukaryotes, which are less developed or absent in lower cellular systems such as yeast and E. coli. Disadvantages of the insect cell system comprise the tedious generation of baculoviruses, lengthy culture processes, and, with respect to high-resolution heteronuclear NMR, the requirement to supply isotope-labeled amino acids to the medium, since insect cells do not produce amino acids from simple precursors like glucose and ammonium. The latter disadvantage can be alleviated to some extent in a cost-effective manner by feeding isotope-labeled yeast or algal extracts to the insect cells (Franke et al. 2018).
In contrast, expression in E. coli offers several particular advantages, such as inexpensive (isotope-labeled) growth media, easy genetic modification, growth to high cell densities, and simple and fast scale-up processes. These features have made E. coli the most used expression system for soluble proteins. However, heterologous expression of eukaryotic membrane proteins is considerably more difficult in E. coli for numerous reasons, comprising the lack of the endoplasmic reticulum and Golgi apparatus quality control and the more evolved post-translational modification (PTM) and membrane insertion machineries present in eukaryotes as well as inherent toxicity. Nevertheless, many examples exist of the successful E. coli expression of important eukaryotic membrane proteins, including GPCRs. In order to overcome the described difficulties, almost always empirical optimization of diverse parameters such as expression constructs, E. coli strains, induction, temperature, etc. is required. Without doubt, protein engineering towards higher stability has been the most import step to the success of GPCR structural studies both in eukaryotic and non-eukaryotic expression systems. Such stabilizing sequence modifications comprise loop deletions, protein insertions (T4 lysozyme, rubredoxin, etc.), and extensive point mutations (Cherezov et al. 2007; Rosenbaum et al. 2007; Warne et al. 2008; Sarkar et al. 2008; Shibata et al. 2009; Miller and Tate 2011). An ingenious method for directed evolution of GPCRs in E. coli towards high expression and stability has been developed by the Plückthun group (Sarkar et al. 2008; Dodevski and Plückthun 2011; Schlinkmann et al. 2012) using iterative rounds of gene randomization and selection based on fluorescence-labeled ligand binding.
Although the work described here uses E.coli in-cell expression of GPCRs, we briefly want to mention that also cell-free synthesis is possible in E.coli lysates (Henrich et al. 2015). While the latter method has been successful for the production of certain ligand-binding competent GPCRs (Klammt et al. 2007; Kögler et al. 2019), a recent NMR characterization of the cell-free expressed neurotensin receptor 1 indicated a lack of tertiary structure and that further improvements to the method were necessary (Shilling et al. 2017).
In the following, we first give an overview on previous strategies to produce GPCRs for structural studies from in-cell E. coli expression and then further develop these into a robust, quantitative protocol for the E. coli production of two turkey β1-adrenergic receptor (β1AR) mutants, which had previously been optimized for thermal stability in insect cells and expressed in these eukaryotic cells leading to successful crystallization (Warne et al. 2008) and detailed NMR studies (Isogai et al. 2016; Abiko et al. 2019; Grahl et al. 2020). The first ultrastable β1AR mutant (TS-β1AR, melting temperature Tm = 59 °C), harboring 12 point mutations and truncations at the N- and C-termini, is competent for orthosteric ligand binding, but deficient in G protein activation (Isogai et al. 2016). The second TS-β1ARA227Y/L343Y double mutant (named YY-β1AR in the following) recovers G protein activation by reintroducing the conserved tyrosines Y5.58 and Y7.53 [the superscript corresponds to Ballesteros-Weinstein numbering (Ballesteros and Weinstein 1995)] in TM5 and TM7 at the expense of stability (Tm = 48 °C) (Isogai et al. 2016). Both mutants do not carry PTMs such as palmitoylation, which were not necessary for successful structural studies. The 2D 1H-15N NMR spectra of different ligand-bound forms of the E. coli-expressed β1AR mutants including a ternary complex of YY-β1AR with the agonist isoprenaline and the G protein mimicking nanobody Nb80 (Rasmussen et al. 2011) are identical to spectra obtained from insect-cell expressed receptors. The described protocol for E. coli β1AR expression and purification should be applicable to other GPCRs of sufficient stability. Such an adaptation is aided by the quantification of receptor amounts at each step of the purification protocol and by the introduction of restriction sites into the expression plasmid, which allow an easy replacement of β1AR by other GPCR genes of interest.
Results and discussion
Overview of previous strategies for GPCR expression and purification using E. coli
To learn from past experience, we reviewed 50 of the previous studies on GPCR expression in E. coli (Supplementary Table S1). They cover 37 distinct receptors, with the neurotensin receptor (NTS1) being the most studied (Fig. 1a). Of the analyzed protocols, 37% used expression in inclusion bodies and refolding, whereas 63% aimed at the insertion of the properly folded receptor into the E. coli inner membrane (Fig. 1c).
Expression in inclusion bodies usually generates high amounts of material, but refolding can be very challenging for GPCRs in particular with regard to finding the proper membrane mimetics and the correct formation of disulfide bonds. Nevertheless, the CXCR1, Y2, and GRH-R1a receptors have been obtained from E. coli inclusion bodies and refolded into phospholipid bilayers for successful structure determination, modeling or dynamics measurements using solid-state NMR data (Park et al. 2012; Schmidt et al. 2014; Schrottke et al. 2017; Bender et al. 2019).
Expression directed to the membrane has been used for many different GPCRs (Bertin et al. 1992; Tucker and Grisshammer 1996; Stanasila et al. 1999; Furukawa and Haga 2000; Hampe et al. 2000; Weiß and Grisshammer 2002; Yeliseev et al. 2005; Grisshammer et al. 2005; Dodevski and Plückthun 2011) and led to successful structural studies of NTS1 (Egloff et al. 2014; Nasr et al. 2017), α1A (Wu et al. 2020), and α1B (Schuster et al. 2020). In almost all cases, membrane insertion has been achieved with an expression construct originally described for NTS1 (Tucker and Grisshammer 1996). In this construct (pRG/III-hs-MBP), the receptor is fused at the N-terminus to the periplasmic maltose-binding protein (MBP) together with its signaling peptide, as well as at the C-terminus to the cytoplasmic thioredoxin A (TrxA) followed by a histidine tag. The N-terminal MBP fusion directs the first GPCR helix towards the periplasm, thereby inducing the correct orientation of the following helices, such that the outside of the folded receptor points to the periplasm and the inside to the cytoplasm. MBP is by far the most used fusion protein (42%, Fig. 1d) for GPCR E. coli expression. The C-terminal TrxA fusion is not important for the proper membrane insertion, but increased the expression levels of many receptors (NTS1, CB2, NK1, α1A, α2A, CCR3, CCR5, CX3CR1, CXCR4), which appears due a stabilizing effect by this soluble, compact protein (Tucker and Grisshammer 1996; Yeliseev et al. 2005; Ren et al. 2009; Dodevski and Plückthun 2011). Other stable, cytosolic proteins such as glutathione S-transferase (GST) have also been found to increase GPCR expression yield and stability in inclusion bodies (Kiefer et al. 1996; Park et al. 2012) (Fig. 1d).
Of note, also low temperature (16–25 °C) and low inducer concentrations (0.5–0.1 mM IPTG) have been used for the majority of natively expressed GPCRs in E. coli to slow the transcription rate and ensure correct translocation to the membrane without aggregation (Supplementary Table S1).
Once the problems of heterologous expression and membrane insertion are overcome, the next challenging step is the extraction from the host membrane. For GPCRs, the most common extraction detergents are the maltosides DDM and DM mixed with cholesteryl hemisuccinate (CHS), or zwitterionic surfactants such as CHAPS (Fig. 1b). It should be noted that although alkylphosphocholine (FC) detergents have been widely used for solution NMR studies of membrane proteins, there are now many examples showing their destabilizing and inactivating effects in particular for α-helical proteins (Chipot et al. 2018).
For immunodetection and downstream purification of the detergent-solubilized receptors histidine tags fused to the C-terminal region are used in most (81%) cases (Fig. 1e). In a direct comparison, a His10 tag proved more efficient for nickel affinity purification of NTS1 than a His6 tag (Grisshammer and Tucker 1997).
In the following, we have translated and optimized these strategies to the high-yield E. coli expression and purification of the two TS-β1AR and YY-β1AR mutants of the turkey β1AR, which we had previously used in isotope-labeled form from insect cells for NMR dynamical studies (Isogai et al. 2016; Abiko et al. 2019; Grahl et al. 2020).
Optimization of the expression vector
The TS-β1AR mutant (Isogai et al. 2016) was first cloned from the insect cell vector into the E. coli expression vector pRG/III-hs-MBP (Tucker and Grisshammer 1996). In the original pRG/III-hs-MBP, TS-β1AR is linked to the N- and C-terminal MBP and Trx fusion proteins via thrombin protease cleavage sites. However, cleavage by thrombin resulted in aggregation of the receptor. Therefore, we replaced these sites by cleavage sites for the more selective HRV 3C protease (Waugh 2011), and additionally separated them on each side from the protein sequences by (GS)5 linkers (Fig. 2a). Using HRV 3C overcame the aggregation problem, while the (GS)5 linkers increased the efficiency of HRV 3C cleavage by about 70%, apparently by making the cleavage sites more accessible. To facilitate the use of the construct for other GPCRs or transmembrane proteins and replacement by respective genes of interest, we also added the two endonuclease restriction site sequences NdeI and AgeI upstream and downstream of the β1AR gene (Fig. 2a). The YY-β1AR mutant vector, which encodes the G protein binding-competent β1AR, was obtained from this TS-β1AR vector by reintroducing the two native tyrosines via the point mutations A227Y and L343Y.
Protein expression
Following previous experience (Supplementary Table S1), the β1AR expression in E. coli was carried out at a reduced temperature of 22 °C as described previously to slow down protein synthesis and increase the efficiency of lipid bilayer insertion (Hampe et al. 2000; Weiß and Grisshammer 2002; White et al. 2004; Shibata et al. 2009). Minimal media were used throughout to optimize for isotope labelling in NMR experiments. Several parameters were screened to improve the expression levels of the TS-β1AR vector as quantified by western blot against the C-terminal His10 tag. Of the four tested E. coli strains standard BL21(DE3) and its derivatives pLysS, Rosetta 2, and (CodonPlus) RIL (Fig. 2b), Rosetta 2 achieved the highest expression level. This was followed by 20–30% lower expression levels for pLysS and RIL. The standard BL21(DE3) cells expressed only a third of Rosetta 2. The higher expression levels of Rosetta 2 and RIL must result from their additional tRNAs for rare E. coli codons. Of note, the TS-β1AR gene had been taken from the insect cell expression vector and not been codon-optimized for E. coli. As an alternative, the receptor gene may be codon-optimized for E. coli, but such a strategy may become costly when studying a large number of different receptors (Petrovskaya et al. 2010). The increased expression level of pLysS may be attributed to the better suppression of basal expression in these cells.
We also tested the effect of cholesterol, since it has been reported to stabilize GPCRs (Gimpl and Fahrenholz 2002; Pucadyil and Chattopadhyay 2006; Prasanna et al. 2014) and indeed also stabilizes TS-β1AR (see below). However, the addition of 20 mg/L cholesterol to the growth medium had no effect on the expression level (Fig. 2c), but retarded considerably (~ twofold) E. coli growth. Also a longer expression time (48 h) showed no improvement in comparison to overnight cultures (Fig. 2d).
Based on these test results, all subsequent expressions were carried out using Rosetta 2 without addition of cholesterol in overnight cultures.
Membrane solubilization
Three different conditions were tested for membrane solubilization: 1.5% DM, 1.5% DM + 0.7% CHAPS + 0.15% CHS (cholesteryl hemisuccinate), and 1.5% DDM + 0.7% CHAPS + 0.15% CHS (Fig. 2e). We had previously used 1.5% DM to extract β1AR from the insect cell membranes with good results. However, the DM extraction efficiency was very low for the E. coli membrane and increased considerably when 0.7% CHAPS + 0.15% CHS were added. The efficiency further increased when replacing DM by the longer-chain DDM. Thus the most widely used detergent mixture to extract GPCRs from E. coli membranes (Fig. 1b) also proved most efficient for TS-β1AR. Of note, addition of CHS also increases the TS-β1AR temperature stability (see below).
As we had previously found that the quality of NMR spectra and long-term stability was best for TS-β1AR in DM micelles (Isogai et al. 2016), the β1AR mutants solubilized by the DDM/CHAPS/CHS mixture from the E. coli membrane were exchanged to DM during the subsequent purification steps, which were carried out with 0.15% (nickel affinity) or 0.1% of DM (ion exchange and alprenolol affinity).
Purification strategy
The purification procedure after the membrane solubilization was adapted from the previous protocol for insect cell-expressed β1AR (Isogai et al. 2016). The individual steps of both E. coli and insect cell purification protocols are shown in Fig. 3. The purification consists sequentially of nickel affinity, fast-flow cationic ion exchange, alprenolol affinity (ALAC), and high-performance cationic ion exchange chromatography steps. This is based on the following rationale. The first, fast flow cation exchange (SPFF) chromatography removes many impurities, which are still present in the nickel-eluted fraction, and concentrates the receptor from the large elution volume (90 mL to ~ 25 mL for 4 L culture). This is important for the subsequent ALAC step, since the alprenolol-sepharose resin has low binding capacity (Caron et al. 1979) and the ALAC column requires slow loading (0.1 mL/min). The ALAC step retains only the ligand binding-competent protein and is crucial for a homogeneous sample. The second, high-performance cation exchange (SPHP) chromatography following the ALAC confers an ultra-pure sample and also concentrates the receptor in a mild way without aggregation from the 60-mL ALAC eluate to about 4 mL.
The major difference of the E. coli β1AR construct relative to the insect cell construct is the presence of the MBP and TrxA fusion partners. Thus it is a crucial question at which point of the protocol these fusion partners are removed by cleavage. Since MBP, TS-β1AR and TrxA have very distinct isoelectric points (4.8, 9.6, and 4.3, respectively), the fusion protein is hard to purify by either cationic or anionic ion exchange chromatography. In contrast, the cleaved β1AR is readily separated from MBP and TrxA by ion exchange chromatography. Indeed, cleavage carried out directly after the nickel affinity step instead of the ALAC increased the yield of purified TS-β1AR from 0.17 to 0.25 mg/L in a direct comparison.
Quantitative analysis of the purification steps
The efficiencies of the individual steps in the E. coli and insect cell purification protocols were determined by quantifying western blots or Coomassie-stained gels (Supplementary Figure S1). These efficiencies are indicated in the overall flow diagrams for the two protocols (Fig. 3). Of note, the E. coli purification extends over three days instead of the two days for the insect cell purification due to the additional overnight cleavage step.
Apparently, solubilization was more efficient from E. coli (81%) than from insect cells (56%). As this might have been caused by the different detergent used (1.5% DDM, 0.7% CHAPS, 0.15% CHS vs. DM), we also tested solubilization of the insect cell material by the DDM/CHAPS/CHS mixture. However, no increase in efficiency was observed. Thus the effect must be due to the different membrane composition of E. coli and insect cells. During the following nickel affinity step, the detergent is exchanged for the E. coli material to DM. During this step considerably more β1AR was recovered from the E. coli material (71%) than from the insect cell material (48%). A test with DDM/CHAPS/CHS-solubilized insect cell material showed that the higher yield for the E. coli material in this step was not due to the different detergent mixture. The following cleavage of the E. coli material by the HRV 3C protease was highly efficient (92%). After this step both E. coli and insect cell-derived β1AR samples should be identical in their composition.
Considerable amounts of material are lost in the subsequent purification steps. From the β1AR E. coli material only 23% are recovered after the SPFF ion exchange step in contrast to 47% for the insect cell material. Similarly, also the ALAC column is less efficient for the E. coli (38%) vs. the insect cell (61%) material. We attribute these higher losses for the E. coli material to a appreciably larger fraction of misfolded protein present in this preparation. After filtering out these misfolded receptors, the second cationic exchange elution has similar efficiency for both preparations (41% E. coli vs. 33% insect cell).
The final yields for TS-β1AR and the less stable YY-β1AR mutant purified from E. coli were 1.2 and 0.9 mg from 4-L minimal media cultures, respectively. These yields are about 4 times smaller than from insect cell cultures, but similar to other GPCRs produced from E. coli under native conditions, such as the CB1 and α1A receptors (Link et al. 2008; Wu et al. 2020).
Thermal stability quality tests
As a first test of the quality of the E. coli-derived receptors we used the common CPM (N-[4-(7-diethylamino-4-methyl-3-coumarinyl)phenyl] maleimide) microscale fluorescent stability assay. Both E. coli- and insect cell-derived apo TS-β1AR showed the same well-defined melting temperature Tm of 62 °C (Fig. 4a). Of note, the melting temperature of the entire, uncleaved MBP-TS-β1AR-TrxA fusion protein (Tm = 61 °C) is also close to the values of the isolated receptor. As observed previously for insect cell-derived β1AR (Warne et al. 2009), binding of the antagonist carvedilol increased Tm for the E. coli-derived TS-β1AR by about 15 °C (Fig. 4b). Also the addition of 0.1% CHS increased Tm to 72 °C, while glycerol showed no effect.
Isotope labeling and NMR spectra
15N-labeled samples of TS-β1AR and YY-β1AR were produced with no difficulties using the common E. coli M9 minimal medium for isotope labelling (Green et al. 2012). As a test for proper function, 1H-15N TROSY spectra of 15N-YY-β1AR (Fig. 5) were recorded in binary complexes with the antagonist cyanopindolol, the agonist isoprenaline, and in the ternary complex with isoprenaline and the nanobody Nb80, which binds in the same way to the intracellular side of the receptor as the full G protein (Rasmussen et al. 2011). For each of these distinct functional states, well-dispersed 1H-15N resonances were observed, which are typical of a properly folded protein. Figure 5 shows a superposition of these spectra from uniformly 15N-labeled YY-β1AR obtained from E. coli with spectra from selectively 15N-valine (panel A) or 15N-tyrosine (panel B) labeled YY-β1AR obtained from insect cells in complexes with the same ligands. Clearly the resonances from the sparsely labeled insect cell samples are in very similar positions. In particular, the 1H-15N resonances of V172, V202 and V314, which are located close to the orthosteric ligand head group and the extracellular entrance of the ligand pocket (Fig. 5c), show identical strong variations in the various complexes. These have been identified previously (Abiko et al. 2019; Grahl et al. 2020) with the inactive conformation (cyanopindolol), a mixture in slow chemical exchange between preactive and active conformation (isoprenaline), and the active conformation (isoprenaline + Nb80).
For a more direct comparison with the selectively 15N-valine labeled receptor (TS-β1AR) obtained from insect cells, we also attempted 15N-valine selective labeling in E. coli by the addition of 15N-valine to the unlabeled M9 medium. This yielded the same amount of protein as from uniformly 15N-labeled M9. The TROSY spectrum of cyanopindolol-bound TS-β1AR shows similar resonances as the spectrum of 15N-valine labeled TS-β1AR from insect cells, e.g. for V172, V202, and V314 (Supplementary Figure S2). However, due to the metabolic scrambling of 15N-valine to alanine, isoleucine, glutamate and other branched amino acids (Lacabanne et al. 2018; Sugiki et al. 2018), many additional non-valine resonances are observed for the E. coli-derived receptor whereas the valine resonances are relatively weakened (e.g. V95, which is already weak in the insect cell spectrum, is not even detected in the E. coli spectrum). We attribute these effects to the depletion of the 15N-labeled valine pool from the efficient two-way scrambling and also to the higher mobility of non-valine residues located in surface loops or tails. In principle, the scrambling may be reduced by the use of auxotrophic E. coli strains (Lin et al. 2011), but this approach was not further pursued.
We also tested the production of uniformly 2H,15N-labeled TS-β1AR in E.coli by growing the bacteria in 15N-labeled M9 medium and 100% D2O using standard protocols (Opitz et al. 2019). Protein expression was about half of the amount obtained in 15N M9 medium in H2O. Such reductions in yield are not uncommon for deuterated media, since bacterial growth and metabolism are affected by deuteration (Opitz et al. 2019). Improvements in yield may be achievable by multiple rounds of adaptation and selection or the use of optimized strains (Paliy et al. 2003; Kelpšas and Wachenfeldt 2019).
An NMR sample of 2H,15N-labeled TS-β1AR in complex with the antagonist alprenolol was prepared from this E. coli culture by carrying out the entire solubilization and purification procedure in H2O. Figure 6a shows a comparison of TROSY spectra of this 2H,15N-labeled TS-β1AR alprenolol complex and an identical complex prepared from insect cell-derived TS-β1AR with about 60% 2H and 90% 15N incorporation. The latter was obtained by growing insect cells in H2O and supplying 2H/15N-labeled amino acids via respectively labeled yeast extract (Opitz et al. 2015). Clearly the 1H/15N resonance positions are very close in both spectra indicating that the 2H,15N-labeled TS-β1AR from E. coli is in the same well-folded state as the TS-β1AR from insect cells. However, fewer 1H/15N resonances are observed for the E. coli material. A histogram of the intensity ratios of the resonances from the insect cell and E. coli samples (Fig. 6b) reveals that about a third of the resonances are significantly more intense in the insect cell sample. We attribute this effect to the incomplete back exchange of amide protons during the purification in H2O. This is corroborated by the observation that most of the missing resonances are located in the 1HN downfield region. These 1HN nuclei are part of short hydrogen bonds in well-formed, stable secondary structure elements (Grzesiek et al. 2004). It is obvious that better back exchange of amide protons is necessary for the E. coli-derived 2H,15N-labeled TS-β1AR. This may achievable by slight destabilization of the receptor at higher temperature, higher pressure or by chemical denaturants. Other researcher in the field have reported similar problems of amide proton back exchange for GPCRs grown in 100% deuterated media (K. Wüthrich, personal communication).
Conclusions
We have presented here an optimized protocol for E. coli expression and purification of two β1AR constructs, which had previously been engineered in insect cells for thermal stability and subsequent successful structural and dynamical studies. Of note, this protein engineering comprises the removal of the N-terminal glycosylation and C-terminal palmitoylation, as is often the case in solved GPCR structures (Munk et al. 2019). Thus the absence of the respective PTM machineries did not present a problem for the E. coli expression. Our protocol uses the same genes as in the insect cells and was optimized for 4-L cultures, yielding 0.9 mg of the fully active YY-β1AR, and 1.2 mg for the more thermostable TS-β1AR construct, which is about a quarter of the insect cell yield.
The E. coli sample quality is identical to the insect cell material as assayed by the thermal melting behavior and a direct comparison of backbone 1H-15N spectra of the same receptor constructs obtained from insect cells in 3 different functional states. As such the E. coli-derived β1AR is usable for any structural or biophysical study in the same way as β1AR derived from insect cells.
While the purification steps and time are similar for insect cell- and E. coli-derived receptors, genetic manipulations are much simpler and protein expression is much faster in E. coli. The production of baculovirus and the scaling-up of insect cell cultures typically takes weeks, whereas bacterial expression can be achieved within two days. Furthermore, E. coli offers the advantage of efficient, low-cost, and highly developed procedures (Boisbouvier and Kay 2018) for uniform and very specific isotope labeling.
The approach presented here should be easily transferable to other GPCRs of interest by using the standard restriction sites introduced into the expression plasmid and by comparing the yields at the described quantitative checkpoints in the purification procedure.
Materials and methods
Generation of expression constructs
An optimized expression construct for the turkey β1AR receptor was derived from the vector pRG/III-hs-MBP kindly provided by R. Grisshammer (NIH) by (i) replacement of the NTS1 gene by the thermostabilized TS-β1AR receptor DNA sequence by restriction-free cloning (van den Ent and Löwe 2006), (ii) introduction of two 3C cleavage sites between the MBP and TS-β1AR and between the TS-β1AR and TrxA sequences by site-directed mutagenesis, (iii) addition of two (GS)5 spacers before and after each 3C cleavage site by megaprimer cloning (Zhang et al. 2017), and (iv) introduction of NdeI and AgeI cleavage sites upstream and downstream of the TS-β1AR gene sequence by site-directed mutagenesis (Hemsley et al. 1989). The final fusion protein sequence is summarized in Fig. 2a and the TS-β1AR sequence after the cleavage of fusion proteins by 3C protease is the following:
-
GPGSGSGSGSGHMGAELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASVETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCEFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDRASKRKTSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPKWLFVAFNWLGYANSAMNPIILCRSPDFRKAFKRLLAFPRKADRRLLEGTGSGSGSGSLEVLFQ
For the YY-β1AR construct, the two native tyrosine residues Y227 and Y343 were introduced into TS-β1AR sequence by site-directed mutagenesis. The molecular weight of both TS-β1AR and YY-β1AR proteins is ~ 38 kDa.
Expression of uniformly 15 N-labeled β 1 AR in E. coli
Chemically competent Rosetta 2(DE3) (Novagen) cells were transformed with the optimized expression vectors by heat shock and frozen as a glycerol stock. 100 μL thawed glycerol stock were then used to grow a 5-mL inoculum in Luria–Bertani (LB) medium at 37 °C for 9–10 h. The LB culture was diluted with ~ 100 mL M9 minimal medium (supplemented with 4 g/L of glucose and 1 g/L of 15NH4Cl) to OD600 = 0.1 and grown overnight at 37 °C. On the next day, the culture was diluted into 4 L M9 to OD600 = 0.1 and grown at 37 °C until the OD600 reached 0.6. Subsequently, the temperature was reduced to 22 °C and the culture further grown to OD600 = 0.9. At this point, the expression was induced with 0.25 mM isopropyl-β-D-thiogalactoside (Sigma-Aldrich) and growth continued for 16 h at the same temperature. Then cells were pelleted for 15 min at 5000 r.p.m., resuspended in 70 mL 20 mM Tris pH 7.5, 1 mM EDTA containing 2 tablets of cOmplete™ protease inhibitor cocktail (Hoffmann-La Roche), flash-frozen in liquid nitrogen, and stored at -80 °C until purification.
For testing the effect of cholesterol on expression, a cholesterol stock solution of 20 g/L was prepared in ethanol and added to the M9 media to a final concentration of 20 mg/L before inoculation.
Expression of 15 N-valine-labeled β 1 AR in E. coli
15N-valine-labeled β1AR in E. coli was expressed as described for the 15N-labeled protein with the exception of adding 100 mg/L 15N-valine (Sigma-Aldrich) and 30 mg/L leucine to the 14N4HCl-containing M9 medium.
Expression of uniformly 2 H, 15 N-labeled TS-β 1 AR in E. coli
Uniformly 2H,15N-labeled TS-β1AR was expressed in E. coli using M9 medium prepared in D2O (> 90%) supplemented with 4 g/L of glucose and 1 g/L of 15NH4Cl as described for protonated M9. Prior to expression, cells were gradually adapted to the deuterated medium by 9–16 h steps of growth at 37 °C in 0/100, 30/70, 70/30, and 100/0% deuterated/protonated medium, respectively.
Membrane fraction preparation
Unless otherwise stated, all β1AR purification steps were carried out at 4 °C. Thawed cells from a 4-L culture were passed 3 times through a pre-cooled French pressure cell at 2000 psi and ultra-centrifuged at 140,000×g for 1 h. For solubilization, the pellet was suspended in 120 mL 20 mM Tris pH 7.5, 400 mM NaCl, 2.5 mM imidazole, 1.5% DM, 0.7% CHAPS, 0.15% CHS (all detergents obtained from Anatrace). Solubilization was achieved in three steps: (1) 2 × 5 s treatment with an electric homogenizer (Ultra TURRAX™, IKA) equipped with a 7-mm saw tooth dispersing probe at 11.000 r.p.m.; (2) homogenization with a tight-piston Dounce homogenizer; and (3) 2 h of incubation under gentle motion in a roller mixer (Stuart Scientific). The solubilized cells were then ultra-centrifuged at 140,000×g for 30 min. The supernatant containing the solubilized receptor was used for further purification, whereas ¼ of the pellet was resolubilized in 30 mL 20 mM Tris pH 7.5, 200 mM NaCl, 7 M urea for quantification of the remaining insoluble receptor.
Membrane solubilization test
For quantifying the efficiency of membrane solubilization by different detergents, the cells from a 2-L E. coli culture were disrupted, divided into 3 equal parts, and centrifuged as described above. The 3 pellets were then suspended, each in 10 mL 20 mM Tris pH 7.5, 400 mM NaCl, 2.5 mM imidazole + either 1.5% DM or (1.5% DM + 0.7% CHAPS + 0.15% CHS) or (1.5% DDM + 0.7% CHAPS + 0.15% CHS). Solubilization under mechanical agitation and further centrifugation were then carried out as described above. The solubilized supernatant of each sample was purified by Ni affinity and quantified for receptor content by western blot as described below.
Protein purification
The solubilized membrane fraction was incubated for 2 h in a rotator mixer with 15 mL (50% slurry) of Ni–NTA agarose resin (Qiagen) which had been pre-equilibrated with 20 mM Tris pH 7.5, 350 mM NaCl. The resin was washed using two centrifugation (5 min, 1000 r.p.m, in an Eppendorf 5430 R centrifuge) and resuspension steps (90 mL 20 mM Tris pH 7.5, 850 mM NaCl, 15 mM imidazole, 0.15% DM; 70 mL of 20 mM Tris pH 7.5, 350 mM NaCl, 15 mM imidazole, 0.15% DM). The washed resin was placed in a column on top of 2 mL additional resin. β1AR was eluted by gravity flow with 90 mL 20 mM Tris pH 7.5, 350 mM NaCl, 250 mM imidazole, 0.15% DM. This eluted fraction was then incubated overnight with 20 mg of home-made 3C protease [produced according to (Ullah et al. 2016)] in a rotator mixer (Stuart Scientific).
On the following day, this fraction incubated with 3C protease was diluted to a volume of 180 mL with buffer IEX A (20 mM Tris pH 7.5, 1 mM EDTA, 0.1% DM) and applied to a 5 mL SP Sepharose™ Fast Flow cation exchange column (GE healthcare), washed with 20 mL of buffer IEX A, and eluted with a gradient from 5 to 100% of buffer IEX B (20 mM Tris pH 7.5, 1 mM EDTA, 2 M NaCl, 0.1% DM). β1AR eluted at ~ 30% of IEX B. The eluted peak was collected and applied to a 5-mL alprenolol-sepharose affinity column (ALAC) prepared as described in (Hemsley et al. 1989). Non-binding protein was slowly washed out (0.1 mL/min) with 60 mL 20 mM Tris pH 7.5, 1 mM EDTA, 750 mM NaCl, 0.1% DM and the binding-competent β1AR was eluted with 60 mL of the same buffer containing 1 mM of the inverse-agonist atenolol.
The eluted fraction from the ALAC was diluted to 200 mL with buffer IEX A and applied to a 5-mL SP Sepharose™ High Performance column (GE healthcare), washed with 20 mL buffer IEX A, and eluted with a gradient from 7 to 90% of IEX B. The pure, homogeneous β1AR eluted at ~ 49% of IEX B. This fraction was collected, buffer-exchanged to 20 mM Tris pH 7.5, 1 mM EDTA, 100 mM NaCl, 0.1% DM and concentrated to ~ 250 μL using a 50-kDa molecular weight cut-off Amicon centrifugal filter (Millipore). Receptor concentrations were estimated by OD280 using a Nano-Drop (Thermo Scientific™) UV–Vis spectrophotometer and a theoretical extinction coefficient of 66,055 M−1 cm−1.
For complex formation with the higher-affinity, ortho-steric ligands cyanopindolol or isoprenaline, the low-affinity ligand alprenolol was exchanged as described previously (Isogai et al. 2016). In brief, the samples were washed repeatedly first with buffer devoid of ligand and then with buffer containing the higher-affinity ligand of interest. Final ligand concentrations were 1 mM cyanopindolol or 2 mM isoprenaline (+ 20 mM sodium ascorbate for stability). For formation of the ternary YY-β1AR complex, a 1.2 molar equivalent of Nb80 [prepared as described previously (Rasmussen et al. 2011)] was added to the preformed isoprenaline∙YY-β1AR complex.
Expression and purification of selectively 15 N-valine-, 15 N-tyrosine-, and uniformly 2 H, 15 N-labeled β 1 AR from Sf9 insect cells
Expression of the 15N-valine-labeled YY-β1AR in baculo-virus-infected Sf9 cells, purification, and assignments were carried out as described previously (Isogai et al. 2016). 15N-tyrosine labeled YY-β1AR was expressed similar to the15N-valine-labeled receptor by replacing the 100 mg/L 15N-valine by 150 mg/L 15N-tyrosine in the expression media. 60% 2H, 90% 15N-labeled TS-β1AR was expressed in baculovirus-infected Sf9 insect cells grown on 2H-15N-labeled yeast extract and purified as described previously (Opitz et al. 2015).
Quantitative analysis of receptor from gel electrophoresis and western blotting
At every step of the purification, the amount of receptor was quantified by SDS/PAGE followed by western blotting against the histidine-tagged receptor using chemiluminescence. For this, 10 μL of the respective fractions were diluted with 10 μL SDS–PAGE buffer (125 mM Tris–HCl pH 6.8, 4% (w/v) SDS, 20% (v/v) glycerol and 0.01% (w/v) bromophenol blue) and loaded onto Mini-PROTEAN TGX™ 4–20% precast gels (Bio-Rad). As a reference, 7 μL of Precision Plus Protein™ dual color standard weight ladder (#1610374, Bio-Rad) were also loaded onto the gel, and the proteins separated for 30 min at 200 V. The gel was then stained with Coomassie brilliant blue and images recorded using an Epson Perfection V800 Photo scanner at 600 dpi resolution. Fractions from the different steps of the preparation loaded onto the same gel were quantified in their relative β1AR amount by densitometry (see below).
For better identification and quantification β1AR was also analyzed by western blots in the early purification steps. For this, proteins were transferred to 0.2 μm nitrocellulose membranes using the Trans-Blot Turbo™ transfer system (Bio-Rad). Western-blot membranes were treated with HRP anti-His tag antibody (BioLegend) and Lumi-Light Western Blotting Substrate (Hoffmann-La Roche). The chemiluminescence signal was detected using a Fusion FX6 reader (Vilber) at 600 dpi resolution.
Individually selected bands of the obtained images from the SDS-PAGE gels and from the western blot membranes were quantified by ImageJ (Schindelin et al. 2012) after background subtraction using the rolling ball radius method (50 pixels).
Thermal stability assays
The melting temperatures of the full-length MBP-TS-β1AR-TrxA fusion and of TS-β1AR isolated from E. coli as well as insect cells under various conditions were determined by following the fluorescence of added N-[4-(7-diethylamino-4-methyl-3-coumarinyl)phenyl]maleimide (CPM) using a Qiagen Rotorgene QPCR thermocycler. For this, ~ 1.5 μL of ~ 1 mg/mL receptor were diluted in 20 mM Tris pH 7.5, 1 mM EDTA, 750 mM NaCl, 0.1% DM, 1 mM atenolol (and optionally 10% glycerol, 0.1% CHS, or 1 mM carvedilol) to a final volume of 60 μL and incubated for 1 h on ice. After incubation, 5 μL of a 186 μM solution of CPM in DMSO was added to each sample (final concentration ~ 14 μM). The GPCR thiol-CPM conjugate fluorescence (excitation 387 nm, emission 463 nm) was monitored while increasing the temperature from 25 to 90 °C at a rate of 2 °C/minute. For every condition, 3 replicates were measured.
NMR experiments
NMR samples were prepared in 5-mm Shigemi tubes as ~ 250-μL volumes of ~ 100 μM protonated (~ 20 μM E. coli-derived deuterated) receptor complexes in 20 mM Tris pH 7.5, 1 mM EDTA, 100 mM NaCl, 37 mM DM, 0.02% NaN3, 5% D2O. All NMR experiments were carried out on a Bruker AVANCE 21.2 T (900 MHz) spectrometer equipped with a TCI cryoprobe at a temperature of 304 K. Unless stated otherwise, 1H-15N TROSY experiments were recorded as 80/120 (15N) × 1024 (1H) complex points with acquisition times of 16/24 ms (15N) and 42 ms (1H) for protonated/deuterated samples, respectively. For optimal sensitivity, the 1H-15 N transfer time was reduced to 3.0 ms using a 1 s interscan delay. Typical total experimental times were 48 h.
All NMR spectra were processed with NMRPipe (Delaglio et al. 1995) and evaluated with CcpNmr Analysis (Vranken et al. 2005).
Supporting information
Supplementary Figures S1, S2 showing details of β1AR expression optimization and purification as well as TROSY spectra of 15N-valine selectively labeled TS-β1AR; Supplementary Table S1 giving an overview of the most important approaches used in previous studies of GPCR expression in E. coli.
Data availability
All data generated or analyzed during this study are included in this published article and its supplementary information files.
References
Abiko LA, Grahl A, Grzesiek S (2019) High pressure shifts the β1-adrenergic receptor to the active conformation in the absence of G protein. J Am Chem Soc 141:16663–16670. https://doi.org/10.1021/jacs.9b06042
Alexander SP, Christopoulos A, Davenport AP et al (2017) THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: G protein-coupled receptors. Br J Pharmacol 174(Suppl 1):S17–S129. https://doi.org/10.1111/bph.13878
Ballesteros JA, Weinstein H (1995) Integrated methods for the construction of three-dimensional models and computational probing of structure-function relations in G protein-coupled receptors. In: Sealfon SC (ed) Methods in neurosciences. Academic Press, San Diego, pp 366–428
Bender BJ, Vortmeier G, Ernicke S et al (2019) Structural model of ghrelin bound to its G protein-coupled receptor. Structure 27:537-544.e4. https://doi.org/10.1016/j.str.2018.12.004
Bertin B, Freissmuth M, Breyer RM et al (1992) Functional expression of the human serotonin 5-HT1A receptor in Escherichia coli. Ligand binding properties and interaction with recombinant G protein alpha-subunits. J Biol Chem 267:8200–8206
Boisbouvier J, Kay LE (2018) Advanced isotopic labeling for the NMR investigation of challenging proteins and nucleic acids. J Biomol NMR 71:115–117. https://doi.org/10.1007/s10858-018-0199-9
Caron MG, Srinivasan Y, Pitha J et al (1979) Affinity chromatography of the beta-adrenergic receptor. J Biol Chem 254:2923–2927
Casiraghi M, Damian M, Lescop E et al (2018) Illuminating the energy landscape of GPCRs: the key contribution of solution-state NMR associated with Escherichia coli as an expression host. Biochemistry 57:2297–2307. https://doi.org/10.1021/acs.biochem.8b00035
Cherezov V, Rosenbaum DM, Hanson MA et al (2007) High-resolution crystal structure of an engineered human β2-adrenergic G protein–coupled receptor. Science 318:1258. https://doi.org/10.1126/science.1150577
Chipot C, Dehez F, Schnell JR et al (2018) Perturbations of native membrane protein structure in alkyl phosphocholine detergents: a critical assessment of NMR and biophysical studies. Chem Rev 118:3559–3607. https://doi.org/10.1021/acs.chemrev.7b00570
Delaglio F, Grzesiek S, Vuister GW et al (1995) NMRPipe: a multidimensional spectral processing system based on UNIX pipes. J Biomol NMR 6:277–293. https://doi.org/10.1007/BF00197809
Dodevski I, Plückthun A (2011) Evolution of three human GPCRs for higher expression and stability. J Mol Biol 408:599–615. https://doi.org/10.1016/j.jmb.2011.02.051
Egloff P, Hillenbrand M, Klenk C et al (2014) Structure of signaling-competent neurotensin receptor 1 obtained by directed evolution in Escherichia coli. Proc Natl Acad Sci USA 111:E655. https://doi.org/10.1073/pnas.1317903111
Franke B, Opitz C, Isogai S et al (2018) Production of isotope-labeled proteins in insect cells for NMR. J Biomol NMR 22:1–12. https://doi.org/10.1007/s10858-018-0172-7
Furukawa H, Haga T (2000) Expression of functional M2 muscarinic acetylcholine receptor in Escherichia coli. J Biochem 127:151–161. https://doi.org/10.1093/oxfordjournals.jbchem.a022577
Gimpl G, Fahrenholz F (2002) Cholesterol as stabilizer of the oxytocin receptor. Biochim Biophys Acta 1564:384–392. https://doi.org/10.1016/S0005-2736(02)00475-3
Grahl A, Abiko LA, Isogai S et al (2020) A high-resolution description of β 1 -adrenergic receptor functional dynamics and allosteric coupling from backbone NMR. Nat Commun 11:2216. https://doi.org/10.1038/s41467-020-15864-y
Green MR, Sambrook J, Sambrook J (2012) Molecular cloning: a laboratory manual, 4th edn. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY
Grisshammer R, Tucker J (1997) Quantitative evaluation of neurotensin receptor purification by immobilized metal affinity chromatography. Protein Expr Purif 11:53–60. https://doi.org/10.1006/prep.1997.0766
Grisshammer R, White JF, Trinh LB, Shiloach J (2005) Large-scale expression and purification of a G-protein-coupled receptor for structure determination—an overview. J Struct Funct Genomics 6:159–163. https://doi.org/10.1007/s10969-005-1917-6
Grzesiek S, Cordier F, Jaravine V, Barfield M (2004) Insights into biomolecular hydrogen bonds from hydrogen bond scalar couplings. Prog Nucl Magn Reson Spectrosc 45:275–300
Hampe W, Voss R-H, Haase W et al (2000) Engineering of a proteolytically stable human β2-adrenergic receptor/maltose-binding protein fusion and production of the chimeric protein in Escherichia coli and baculovirus-infected insect cells. J Biotechnol 77:219–234. https://doi.org/10.1016/S0168-1656(99)00216-3
Hauser AS, Attwood MM, Rask-Andersen M et al (2017) Trends in GPCR drug discovery: new agents, targets and indications. Nat Rev Drug Discovery 16:829–842. https://doi.org/10.1038/nrd.2017.178
Hemsley A, Arnheim N, Toney MD et al (1989) A simple method for site-directed mutagenesis using the polymerase chain reaction. Nucleic Acids Res 17:6545–6551
Henrich E, Hein C, Dötsch V, Bernhard F (2015) Membrane protein production in Escherichia coli cell-free lysates. FEBS Lett 589:1713–1722. https://doi.org/10.1016/j.febslet.2015.04.045
Isogai S, Deupi X, Opitz C et al (2016) Backbone NMR reveals allosteric signal transduction networks in the β1-adrenergic receptor. Nature 530:237–241. https://doi.org/10.1038/nature16577
Kelpšas V, von Wachenfeldt C (2019) Strain improvement of Escherichia coli K-12 for recombinant production of deuterated proteins. Sci Rep 9:1–9. https://doi.org/10.1038/s41598-019-54196-w
Kiefer H, Krieger J, Olszewski JD et al (1996) Expression of an olfactory receptor in Escherichia coli: purification, reconstitution, and ligand binding. Biochemistry 35:16077–16084. https://doi.org/10.1021/bi9612069
Klammt C, Srivastava A, Eifler N et al (2007) Functional analysis of cell-free-produced human endothelin B receptor reveals transmembrane segment 1 as an essential area for ET-1 binding and homodimer formation. FEBS J 274:3257–3269. https://doi.org/10.1111/j.1742-4658.2007.05854.x
Kögler LM, Stichel J, Kaiser A, Beck-Sickinger AG (2019) Cell-Free expression and photo-crosslinking of the human neuropeptide Y2 receptor. Front Pharmacol 10:176. https://doi.org/10.3389/fphar.2019.00176
Lacabanne D, Meier BH, Böckmann A (2018) Selective labeling and unlabeling strategies in protein solid-state NMR spectroscopy. J Biomol NMR 71:141–150. https://doi.org/10.1007/s10858-017-0156-z
Link AJ, Skretas G, Strauch E-M et al (2008) Efficient production of membrane-integrated and detergent-soluble G protein-coupled receptors in Escherichia coli. Protein Sci 17:1857–1863. https://doi.org/10.1110/ps.035980.108
Lundstrom K, Wagner R, Reinhart C et al (2006) Structural genomics on membrane proteins: comparison of more than 100 GPCRs in 3 expression systems. J Struct Funct Genomics 7:77–91. https://doi.org/10.1007/s10969-006-9011-2
McCusker EC, Bane SE, O’Malley MA, Robinson AS (2007) Heterologous GPCR expression: a bottleneck to obtaining crystal structures. Biotechnol Prog 23:540–547. https://doi.org/10.1021/bp060349b
Milić D, Veprintsev DB (2015) Large-scale production and protein engineering of G protein-coupled receptors for structural studies. Front Pharmacol 6:66. https://doi.org/10.3389/fphar.2015.00066
Miller JL, Tate CG (2011) Engineering an ultra-thermostable β1-adrenoceptor. J Mol Biol 413:628–638. https://doi.org/10.1016/j.jmb.2011.08.057
Munk C, Mutt E, Isberg V et al (2019) An online resource for GPCR structure determination and analysis. Nat Methods 16:151–162. https://doi.org/10.1038/s41592-018-0302-x
Nasr ML, Baptista D, Strauss M et al (2017) Covalently circularized nanodiscs for studying membrane proteins and viral entry. Nat Methods 14:49–52. https://doi.org/10.1038/nmeth.4079
Opitz C, Isogai S, Grzesiek S (2015) An economic approach to efficient isotope labeling in insect cells using homemade 15N-, 13C- and 2H-labeled yeast extracts. J Biomol NMR 62:373–385. https://doi.org/10.1007/s10858-015-9954-3
Opitz C, Ahrné E, Goldie KN et al (2019) Deuterium induces a distinctive Escherichia coli proteome that correlates with the reduction in growth rate. J Biol Chem 294:2279–2292. https://doi.org/10.1074/jbc.RA118.006914
Paliy O, Bloor D, Brockwell D et al (2003) Improved methods of cultivation and production of deuteriated proteins from E. coli strains grown on fully deuteriated minimal medium. J Appl Microbiol 94:580–586. https://doi.org/10.1046/j.1365-2672.2003.01866.x
Park SH, Das BB, Casagrande F et al (2012) Structure of the chemokine receptor CXCR1 in phospholipid bilayers. Nature 491:779–783. https://doi.org/10.1038/nature11580
Petrovskaya LE, Shulga AA, Bocharova OV et al (2010) Expression of G-protein coupled receptors in Escherichia coli for structural studies. Biochem Moscow 75:881–891. https://doi.org/10.1134/S0006297910070102
Prasanna X, Chattopadhyay A, Sengupta D (2014) Cholesterol modulates the dimer interface of the β2-adrenergic receptor via cholesterol occupancy sites. Biophys J 106:1290–1300. https://doi.org/10.1016/j.bpj.2014.02.002
Pucadyil TJ, Chattopadhyay A (2006) Role of cholesterol in the function and organization of G-protein coupled receptors. Prog Lipid Res 45:295–333. https://doi.org/10.1016/j.plipres.2006.02.002
Rasmussen SGF, Choi H-J, Fung JJ et al (2011) Structure of a nanobody-stabilized active state of the β 2 adrenoceptor. Nature 469:175–180. https://doi.org/10.1038/nature09648
Ren H, Yu D, Ge B et al (2009) High-level production, solubilization and purification of synthetic human GPCR chemokine receptors CCR5, CCR3, CXCR4 and CX3CR1. PLoS ONE 4:e4509. https://doi.org/10.1371/journal.pone.0004509
Rosenbaum DM, Cherezov V, Hanson MA et al (2007) GPCR engineering yields high-resolution structural insights into β2-adrenergic receptor function. Science 318:1266–1273. https://doi.org/10.1126/science.1150609
Saarenpää T, Jaakola V-P, Goldman A (2015) Chapter nine—baculovirus-mediated expression of GPCRs in insect cells. In: Shukla AK (ed) Methods in enzymology. Academic Press, San Diego, pp 185–218
Sarkar CA, Dodevski I, Kenig M et al (2008) Directed evolution of a G protein-coupled receptor for expression, stability, and binding selectivity. Proc Natl Acad Sci USA 105:14808–14813. https://doi.org/10.1073/pnas.0803103105
Schindelin J, Arganda-Carreras I, Frise E et al (2012) Fiji: an open-source platform for biological-image analysis. Nat Methods 9:676–682. https://doi.org/10.1038/nmeth.2019
Schlinkmann KM, Hillenbrand M, Rittner A et al (2012) Maximizing detergent stability and functional expression of a GPCR by exhaustive recombination and evolution. J Mol Biol 422:414–428. https://doi.org/10.1016/j.jmb.2012.05.039
Schmidt P, Thomas L, Müller P et al (2014) The G-protein-coupled neuropeptide Y receptor Type 2 is highly dynamic in lipid membranes as revealed by solid-State NMR spectroscopy. Chemistry 20:4986–4992. https://doi.org/10.1002/chem.201304928
Schrottke S, Kaiser A, Vortmeier G et al (2017) Expression, functional characterization, and solid-state NMR investigation of the G protein-coupled GHS receptor in bilayer membranes. Sci Rep 7:46128. https://doi.org/10.1038/srep46128
Schuster M, Deluigi M, Pantić M et al (2020) Optimizing the α1B-adrenergic receptor for solution NMR studies. Biochim Biophys Acta. https://doi.org/10.1016/j.bbamem.2020.183354
Shibata Y, White JF, Serrano-Vega MJ et al (2009) Thermostabilization of the neurotensin receptor NTS1. J Mol Biol 390:262–277. https://doi.org/10.1016/j.jmb.2009.04.068
Shilling PJ, Bumbak F, Scott DJ et al (2017) Characterisation of a cell-free synthesised G-protein coupled receptor. Sci Rep 7:1094. https://doi.org/10.1038/s41598-017-01227-z
Stanasila L, Massotte D, Kieffer BL, Pattus F (1999) Expression of δ, κ and µ human opioid receptors in Escherichia coli and reconstitution of the high-affinity state for agonist with heterotrimeric G proteins. Eur J Biochem 260:430–438. https://doi.org/10.1046/j.1432-1327.1999.00187.x
Sugiki T, Furuita K, Fujiwara T, Kojima C (2018) Amino acid selective 13C labeling and 13C scrambling profile analysis of protein α and side-chain carbons in Escherichia coli utilized for protein nuclear magnetic resonance. Biochemistry 57:3576–3589. https://doi.org/10.1021/acs.biochem.8b00182
Tate CG (2001) Overexpression of mammalian integral membrane proteins for structural studies. FEBS Lett 504:94–98. https://doi.org/10.1016/S0014-5793(01)02711-9
Tucker J, Grisshammer R (1996) Purification of a rat neurotensin receptor expressed in Escherichia coli. Biochem J 317:891–899. https://doi.org/10.1042/bj3170891
Ullah R, Shah MA, Tufail S et al (2016) Activity of the human rhinovirus 3C protease studied in various buffers, additives and detergents solutions for recombinant protein production. PLoS ONE 11:e0153436. https://doi.org/10.1371/journal.pone.0153436
van den Ent F, Löwe J (2006) RF cloning: a restriction-free method for inserting target genes into plasmids. J Biochem Biophys Methods 67:67–74. https://doi.org/10.1016/j.jbbm.2005.12.008
Vranken WF, Boucher W, Stevens TJ et al (2005) The CCPN data model for NMR spectroscopy: development of a software pipeline. Proteins 59:687–696. https://doi.org/10.1002/prot.20449
Warne T, Serrano-Vega MJ, Baker JG et al (2008) Structure of a β1-adrenergic G-protein-coupled receptor. Nature 454:486–491. https://doi.org/10.1038/nature07101
Warne T, Serrano-Vega MJ, Tate CG, Schertler GFX (2009) Development and crystallization of a minimal thermostabilised G protein-coupled receptor. Protein Expr Purif 65:204–213. https://doi.org/10.1016/j.pep.2009.01.014
Waugh DS (2011) An overview of enzymatic reagents for the removal of affinity tags. Protein Expr Purif 80:283–293. https://doi.org/10.1016/j.pep.2011.08.005
Weiß HM, Grisshammer R (2002) Purification and characterization of the human adenosine A2a receptor functionally expressed in Escherichia coli. Eur J Biochem 269:82–92. https://doi.org/10.1046/j.0014-2956.2002.02618.x
White JF, Trinh LB, Shiloach J, Grisshammer R (2004) Automated large-scale purification of a G protein-coupled receptor for neurotensin. FEBS Lett 564:289–293. https://doi.org/10.1016/S0014-5793(04)00195-4
Wiseman DN, Otchere A, Patel JH et al (2020) Expression and purification of recombinant G protein-coupled receptors: a review. Protein Expr Purif 167:105524. https://doi.org/10.1016/j.pep.2019.105524
Wu F-J, Williams LM, Abdul-Ridha A et al (2020) Probing the correlation between ligand efficacy and conformational diversity at the α1A-adrenoreceptor reveals allosteric coupling of its microswitches. J Biol Chem. https://doi.org/10.1074/jbc.RA120.012842
Yeliseev AA, Wong KK, Soubias O, Gawrisch K (2005) Expression of human peripheral cannabinoid receptor for structural studies. Protein Sci 14:2638–2653. https://doi.org/10.1110/ps.051550305
Zhang H, Liu C-J, Jiang H et al (2017) Mega primer-mediated molecular cloning strategy for chimaeragenesis and long DNA fragment insertion. Biosci Rep. https://doi.org/10.1042/BSR20160608
Acknowledgements
This work was supported by the Swiss National Science Foundation (Grants 31-149927, 31-173089 to S.G., and CRSK-3_195592 to L.A.A.) and by the Novartis Foundation for Medical-Biological Research (Grant #19B147 to S.G.). We gratefully acknowledge Dr. Reinhard Grisshammer, NIH, for the gift of the pRG/III-hs-MBP vector, Dr. Timothy Sharpe of the Biozentrum Biophysics facility for expert help with the biophysical characterization of β1AR as well as Drs. Anne Grahl, Shin Isogai, and Camilo Perez for helpful discussions.
Funding
Open Access funding provided by University of Basel.
Author information
Authors and Affiliations
Corresponding authors
Additional information
This article is dedicated to Prof. Dr. Rob Kaptein on the occasion of his 80th birthday.
Publisher's Note
Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Supplementary Information
Below is the link to the electronic supplementary material.
Rights and permissions
Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/.
About this article
Cite this article
Abiko, L.A., Rogowski, M., Gautier, A. et al. Efficient production of a functional G protein-coupled receptor in E. coli for structural studies. J Biomol NMR 75, 25–38 (2021). https://doi.org/10.1007/s10858-020-00354-6
Received:
Accepted:
Published:
Issue Date:
DOI: https://doi.org/10.1007/s10858-020-00354-6